Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22520 84 / 3e-22 Domain of unknown function (DUF543) (.1), Domain of unknown function (DUF543) (.2) AT1G72170 80 / 9e-21 Domain of unknown function (DUF543) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009454 [exp] 118 / 8e-35 AT1G22520 120 / 1e-35 Domain of unknown function (DUF543) (.1), Domain of unknown function (DUF543) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G079101 [exp] 97 / 2e-27 AT1G22520 101 / 2e-29 Domain of unknown function (DUF543) (.1), Domain of unknown function (DUF543) (.2) Potri.013G105766 [exp] 91 / 6e-25 AT1G22520 105 / 5e-31 Domain of unknown function (DUF543) (.1), Domain of unknown function (DUF543) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04418 [flax] [poplar] DUF543 Domain of unknown function (DUF543)
Representative CDS sequence Show only first row Show all	>Lus10001541 pacid=23170453 polypeptide=Lus10001541 locus=Lus10001541.g ID=Lus10001541.BGIv1.0 annot-version=v1.0 ATGTCGGAATCCGTAGACGTCAACGCCAAATGGGACGCTTGCATCGATCTCACCGTTCGCCGCACCGTGTACTCTACCATGGCCGGCGCCTTCGGCGGCC TCCTCTTCTGCAGGAGCCCTGTGTCTCGATGGGCTGCTGTAGGCTTTGGTGCAGGAGTTGGCGTTGGAGCTGCATACACTGAGTGCTCTCGTATTTTCGA GGGGTCTCCCGTGACATTGCCAGCTCCTAAGGTGACAAGCAGTCCTCCCACTCCTCCTCCTTCTAAGGTGGTGGAAAGTCCTCCCACTCCTCAGGTGAGT TCGGCTGGCGATATCTTTTTCTGA
AA sequence Show only first row Show all	>Lus10001541 pacid=23170453 polypeptide=Lus10001541 locus=Lus10001541.g ID=Lus10001541.BGIv1.0 annot-version=v1.0 MSESVDVNAKWDACIDLTVRRTVYSTMAGAFGGLLFCRSPVSRWAAVGFGAGVGVGAAYTECSRIFEGSPVTLPAPKVTSSPPTPPPSKVVESPPTPQVS SAGDIFF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G22520			Domain of unknown function (DU...		Lus10001541 [exp]	0	1
AT1G79010			Alpha-helical ferredoxin (.1)		Lus10040456 [exp]	2.6	0.7413
AT2G39725			LYR family of Fe/S cluster bio...		Lus10025710 [exp]	8.1	0.6373
AT4G17420			Tryptophan RNA-binding attenua...		Lus10007800 [exp]	17.9	0.6423
AT3G62790			NADH-ubiquinone oxidoreductase...		Lus10021691 [exp]	21.3	0.6481
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10031084 [exp]	33.4	0.6310
AT2G05840		PAA2	20S proteasome subunit PAA2 (....		Lus10027669 [exp]	34.1	0.6135
AT2G44050		COS1	coronatine insensitive1 suppre...		Lus10018133 [exp]	38.7	0.5822
AT5G66140		PAD2	proteasome alpha subunit D2 (....		Lus10028437 [exp]	41.0	0.5757
AT1G64520		RPN12A	regulatory particle non-ATPase...		Lus10023053 [exp]	43.3	0.5869
AT3G13440			S-adenosyl-L-methionine-depend...		Lus10008072 [exp]	53.4	0.5279

Compare expression of checked genes

Lus10001541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.