Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25950 102 / 9e-30 VATG3 vacuolar ATP synthase G3 (.1) AT3G01390 74 / 3e-18 AVMA10, VMA10 vacuolar membrane ATPase 10 (.1.2) AT4G23710 74 / 3e-18 VAG2 ,VATG2 ,VHA-G2 vacuolar ATP synthase subunit G2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009452 [exp] 183 / 2e-61 AT4G25950 123 / 7e-38 vacuolar ATP synthase G3 (.1) Lus10029418 [exp] 100 / 7e-29 AT3G01390 143 / 7e-46 vacuolar membrane ATPase 10 (.1.2) Lus10004213 [exp] 100 / 8e-29 AT3G01390 143 / 9e-46 vacuolar membrane ATPase 10 (.1.2) Lus10016977 [exp] 99 / 3e-28 AT3G01390 129 / 4e-40 vacuolar membrane ATPase 10 (.1.2) Lus10021301 [exp] 97 / 4e-27 AT4G23710 123 / 1e-37 vacuolar ATP synthase subunit G2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G080700 [exp] 107 / 2e-31 AT4G25950 120 / 8e-37 vacuolar ATP synthase G3 (.1) Potri.010G222000 [exp] 93 / 6e-26 AT3G01390 147 / 2e-47 vacuolar membrane ATPase 10 (.1.2) Potri.008G040300 [exp] 91 / 4e-25 AT3G01390 145 / 2e-46 vacuolar membrane ATPase 10 (.1.2) Potri.013G108300 [exp] 77 / 1e-19 AT3G01390 64 / 2e-14 vacuolar membrane ATPase 10 (.1.2) Potri.019G133701 [exp] 45 / 2e-07 AT4G25950 74 / 1e-18 vacuolar ATP synthase G3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0255 [flax] [poplar] ATP_synthase PF03179 [flax] [poplar] V-ATPase_G Vacuolar (H+)-ATPase G subunit
Representative CDS sequence Show only first row Show all	>Lus10001543 pacid=23170457 polypeptide=Lus10001543 locus=Lus10001543.g ID=Lus10001543.BGIv1.0 annot-version=v1.0 ATGGATCCAATGAGAAGCCAAGGAGGGATTCAGATGCTGCTCTCTGCAGAGCAGGAGGCACAACAGATCGTGGCCGCAGCCAGGAATCTGAAATTGTCGA GGTTAAAGCAGGCAAAGGACGAAGCGGAGAAGGAGGCAGTGAGGTATCGTTTGCAGTTGCAGGCCGAGTTCCAGAAGAAAATATCTGAGGGGAATCCGGC TGCGACAGCGAAGCAACTGGATGAGGACACAATGAAGAGGATTGAGAAGCTTAAGGAATCATCTTCTAAGGTGCAGTCAGAGTTGGTTGACATGCTTGTT AAGTTTGTCACAACGGTCAAGAACTAG
AA sequence Show only first row Show all	>Lus10001543 pacid=23170457 polypeptide=Lus10001543 locus=Lus10001543.g ID=Lus10001543.BGIv1.0 annot-version=v1.0 MDPMRSQGGIQMLLSAEQEAQQIVAAARNLKLSRLKQAKDEAEKEAVRYRLQLQAEFQKKISEGNPAATAKQLDEDTMKRIEKLKESSSKVQSELVDMLV KFVTTVKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25950		VATG3	vacuolar ATP synthase G3 (.1)		Lus10001543 [exp]	0	1
AT1G02050		LAP6	LESS ADHESIVE POLLEN 6, Chalco...		Lus10039904 [exp]	1.4	0.9494
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008534 [exp]	1.7	0.9512
AT1G69180	YABBY	CRC	CRABS CLAW, Plant-specific tra...		Lus10036811 [exp]	4.2	0.9289
AT4G37870		PCK1, PEPCK	phosphoenolpyruvate carboxykin...		Lus10011582 [exp]	6.3	0.8751
AT3G01650		RGLG1	RING domain ligase1 (.1)		Lus10015079 [exp]	6.5	0.9195
AT4G13450			Adenine nucleotide alpha hydro...		Lus10032598 [exp]	7.1	0.8678
					Lus10029087 [exp]	7.7	0.9108
					Lus10024490 [exp]	9.2	0.8834
AT5G51030			NAD(P)-binding Rossmann-fold s...		Lus10043023 [exp]	12.8	0.8615
AT4G15550		IAGLU	indole-3-acetate beta-D-glucos...		Lus10027584 [exp]	13.7	0.8651

Compare expression of checked genes

Lus10001543 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.