Lus10001550 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007187 198 / 3e-67 ND /
Lus10030678 195 / 5e-66 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G185732 198 / 2e-67 ND /
PFAM info
Representative CDS sequence
>Lus10001550 pacid=23156102 polypeptide=Lus10001550 locus=Lus10001550.g ID=Lus10001550.BGIv1.0 annot-version=v1.0
ATGATAGGAAGAGCCGACATCGAAGGATCAAAAAGCAACGTCGCTATGAACGCTTGGCTGCCACAAGCCAGTTATCCCTGTGGTAACTTTTCTGACACCT
CTAGCTTCAAATTCCGAAGGTCTAAAGGATCGATAGGCCACGCTTTCACGGTTCGTATTCGTACTGGAAATCAGAATCAAACGAGCTTTTACCCTTTTGT
TCCACACGAGATTTCTGTTCTCGTTGAGCTCATCTTAGGACACCTGCGTTATCTTTTAACAGATGTGCCGCCCCAGCCAAACAATTTGGCTAAGCTCATA
GCTTGGTAG
AA sequence
>Lus10001550 pacid=23156102 polypeptide=Lus10001550 locus=Lus10001550.g ID=Lus10001550.BGIv1.0 annot-version=v1.0
MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNNLAKLI
AW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001550 0 1
Lus10007187 1.7 0.9689
Lus10008011 2.4 0.9657
Lus10030678 3.0 0.9559
AT1G11340 S-locus lectin protein kinase ... Lus10002717 3.5 0.9505
Lus10000298 3.9 0.9381
Lus10039450 6.5 0.8593
Lus10007186 8.5 0.9089
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10016229 9.7 0.7144
AT1G27461 unknown protein Lus10007752 21.9 0.7119
AT1G26660 Prefoldin chaperone subunit fa... Lus10026631 25.5 0.7680

Lus10001550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.