Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46790 142 / 2e-40 CRR2 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G56690 101 / 7e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G18750 100 / 2e-25 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G04370 98 / 1e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G01580 97 / 2e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G33680 96 / 5e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G30700 96 / 7e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G37170 96 / 8e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G74630 94 / 3e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G09410 93 / 4e-23 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004987 [exp] 192 / 3e-60 AT3G46790 715 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003790 [exp] 100 / 1e-25 AT1G17630 659 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10014956 [exp] 97 / 9e-25 AT5G13230 484 / 1e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10023710 [exp] 97 / 3e-24 AT4G18750 385 / 3e-123 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013149 [exp] 96 / 5e-24 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10007806 [exp] 96 / 8e-24 AT3G03580 967 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009702 [exp] 96 / 8e-24 AT5G27110 409 / 1e-134 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10005064 [exp] 95 / 9e-24 AT2G21090 513 / 2e-179 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10038839 [exp] 95 / 1e-23 AT5G13230 715 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G037600 [exp] 122 / 3e-33 AT3G46790 997 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G087100 [exp] 103 / 1e-26 AT3G29230 368 / 1e-119 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G041200 [exp] 101 / 7e-26 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G005400 [exp] 100 / 2e-25 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G063900 [exp] 99 / 3e-25 AT3G12770 385 / 7e-125 mitochondrial editing factor 22 (.1) Potri.005G006400 [exp] 99 / 4e-25 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G191000 [exp] 97 / 1e-24 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G059400 [exp] 97 / 2e-24 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G211400 [exp] 94 / 3e-23 AT3G11460 772 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G077700 [exp] 94 / 3e-23 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10001558 pacid=23154579 polypeptide=Lus10001558 locus=Lus10001558.g ID=Lus10001558.BGIv1.0 annot-version=v1.0 ATGGTGAGTGTTCTGCAAGCTTGTGCTTCCCTTTCATCTCTGGAGCAAGGGAAGTTGATACACGGATACATTGTCAGGACCTTCTTCGACAGCATCTCGC CTGTTATGAGTGCTTTGATCACAATGTATGCAAAGTGCGGGAAGCTCGAAGTAGCAGAACAAGTTTTCGATGGCATGTGTACGAAGAAAGATGTCATATC TTGGACTTCTTTGATTTCGGGGTATGGATCGCACGGGCAAGGGAAGAAAGCGCTCGAGGTTTTCAACGAGATGATCAGGTGCGGTGTGTCGCCTAGTCCT GTTTCGTTCGTGTCCGTGTTGGGAGCTTGTAGCGTGCTAATCTCGTGGACGAAGCAAAAGGTGTATTCGATTCAATGA
AA sequence Show only first row Show all	>Lus10001558 pacid=23154579 polypeptide=Lus10001558 locus=Lus10001558.g ID=Lus10001558.BGIv1.0 annot-version=v1.0 MVSVLQACASLSSLEQGKLIHGYIVRTFFDSISPVMSALITMYAKCGKLEVAEQVFDGMCTKKDVISWTSLISGYGSHGQGKKALEVFNEMIRCGVSPSP VSFVSVLGACSVLISWTKQKVYSIQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46790		CRR2	CHLORORESPIRATORY REDUCTION 2,...		Lus10001558 [exp]	0	1
AT5G60790		ABCF1, ATGCN1	ARABIDOPSIS THALIANA GENERAL C...		Lus10037947 [exp]	3.0	0.8279
AT4G02750			Tetratricopeptide repeat (TPR)...		Lus10027365 [exp]	6.2	0.8029
AT2G32070			Polynucleotidyl transferase, r...		Lus10003635 [exp]	6.5	0.8206
					Lus10039851 [exp]	14.4	0.7569
AT1G47820			unknown protein		Lus10031924 [exp]	16.6	0.7771
AT5G27930			Protein phosphatase 2C family ...		Lus10029874 [exp]	22.8	0.7651
AT1G20340		PETE2, DRT112	PLASTOCYANIN 2, DNA-DAMAGE-REP...		Lus10021839 [exp]	25.1	0.7908
AT5G66520			Tetratricopeptide repeat (TPR)...		Lus10010909 [exp]	26.5	0.7892
AT1G11840		ATGLX1	glyoxalase I homolog (.1.2.3.4...		Lus10000007 [exp]	26.8	0.7499
AT5G01650			Tautomerase/MIF superfamily pr...		Lus10022681 [exp]	27.5	0.7632

Compare expression of checked genes

Lus10001558 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.