Lus10001570 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02220 44 / 3e-07 unknown protein
AT1G07500 39 / 3e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G100000 35 / 0.0005 AT5G02220 39 / 1e-05 unknown protein
Potri.010G201900 35 / 0.0006 AT5G02220 59 / 1e-13 unknown protein
PFAM info
Representative CDS sequence
>Lus10001570 pacid=23154573 polypeptide=Lus10001570 locus=Lus10001570.g ID=Lus10001570.BGIv1.0 annot-version=v1.0
ATGGACGAAGAAAAAGAACAAGGATCGTCGGAGATGATCAGCGAGGGGTGCCGGACACCTGACCGCGACGAGAATCGGATTCCGGAGCAGAAGCATCCGC
CGCTGCCGCCGATAAAGAAACGTTTGTTGGCGGTGAAGAAGAAGAGGGCGCCGCCGAAGAATGGTTACTTCAACCCTCCCGACCTTGACCTCCTCTTTTC
CAGGCGGGCGGCGGCGCCAGCGGTGTGCTACACTTGA
AA sequence
>Lus10001570 pacid=23154573 polypeptide=Lus10001570 locus=Lus10001570.g ID=Lus10001570.BGIv1.0 annot-version=v1.0
MDEEKEQGSSEMISEGCRTPDRDENRIPEQKHPPLPPIKKRLLAVKKKRAPPKNGYFNPPDLDLLFSRRAAAPAVCYT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02220 unknown protein Lus10001570 0 1
Lus10001825 6.5 0.7937
AT2G26150 HSF ATHSFA2 heat shock transcription facto... Lus10039134 9.4 0.7781
Lus10019329 11.2 0.6702
AT2G41970 Protein kinase superfamily pro... Lus10017242 13.0 0.7730
AT1G52560 HSP20-like chaperones superfam... Lus10024225 13.5 0.7736
Lus10018446 14.7 0.7488
AT5G37670 HSP15.7CI HSP20-like chaperones superfam... Lus10004039 16.2 0.7496
AT4G27670 HSP21 heat shock protein 21 (.1) Lus10014876 17.0 0.7672
AT3G02230 ATRGP1, RGP1 ARABIDOPSIS THALIANA REVERSIBL... Lus10034376 17.5 0.7617
AT5G06920 FLA21 FASCICLIN-like arabinogalactan... Lus10016437 22.6 0.7347

Lus10001570 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.