Plant FIBer expression Database

Lus10001576 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59460 100 / 6e-27 scarecrow-like transcription factor 11 (SCL11) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004969
[exp]
219 / 2e-73 AT5G59460 94 / 5e-24 scarecrow-like transcription factor 11 (SCL11) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G033400
[exp]
150 / 1e-46 AT5G59460 126 / 5e-37 scarecrow-like transcription factor 11 (SCL11) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10175 MPP6 M-phase phosphoprotein 6
Representative CDS sequence
>Lus10001576 pacid=23154580 polypeptide=Lus10001576 locus=Lus10001576.g ID=Lus10001576.BGIv1.0 annot-version=v1.0
ATGGCGAAGCGCGAGATATCTAGTACGCTGAAGAACTTGAAGTTCATGCAAAGGGGAGCTGCGAGAGAAGAGAAACCCAAACAGAAAGAAGAAGAAGAGG
TTAAGCCCAATGGAAACTTTTGCTCTCGTGGAGGTGTTAGAAAGTGTATGGTGGTAATGGAAGGTGATCCCCACCCAGGAGCAGTTATAGGCAGGATGTC
ATTTCGAAGCTTCAATCCTTCTGTCGATAAACTGAATGGAGTAGCAACAAACCCTGAAGAAACAGCAAGTCAGGCAGCATCATCTGCTAGAGAAAATGGA
TCATCAGCAGCGAATGGTTCAGAATCATCCCCAAATTCTGACGGCGGAGACCAGAAGTGGAAACAACCTGACGTAGCTTCTGAAAGAGAGAACTCGAATA
CTACGCCGAGAGGCGCTGAAGGCGGCGAGGGATCATCAAGGAACACCAAGAAAGGTTCATTCAGGCAGAAACGGCAGAAGCTGGACTTCAACGCGCTGAG
AGCGAAAACTCGGAACAACTGA
AA sequence
>Lus10001576 pacid=23154580 polypeptide=Lus10001576 locus=Lus10001576.g ID=Lus10001576.BGIv1.0 annot-version=v1.0
MAKREISSTLKNLKFMQRGAAREEKPKQKEEEEVKPNGNFCSRGGVRKCMVVMEGDPHPGAVIGRMSFRSFNPSVDKLNGVATNPEETASQAASSARENG
SSAANGSESSPNSDGGDQKWKQPDVASERENSNTTPRGAEGGEGSSRNTKKGSFRQKRQKLDFNALRAKTRNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59460 scarecrow-like transcription f... Lus10001576
[exp]
0 1
AT3G62140 unknown protein Lus10009976
[exp]
6.5 0.8727
AT4G28830 S-adenosyl-L-methionine-depend... Lus10043228
[exp]
7.1 0.8880
AT3G62140 unknown protein Lus10038035
[exp]
8.8 0.8751
AT5G60900 RLK1 receptor-like protein kinase 1... Lus10024197
[exp]
10.5 0.7946
AT1G55510 BCDH BETA1, BCD... branched-chain alpha-keto acid... Lus10010324
[exp]
14.4 0.8557
AT5G64180 unknown protein Lus10013157
[exp]
15.5 0.8211
AT2G37970 SOUL-1 SOUL heme-binding family prote... Lus10000106
[exp]
16.7 0.8500
AT4G36290 CRT1 compromised recognition of TCV... Lus10014276
[exp]
21.2 0.8372
AT5G27660 Trypsin family protein with PD... Lus10037815
[exp]
23.1 0.7893
AT3G15660 ATGRX4 A. THALIANA GLUTAREDOXIN 4, gl... Lus10008687
[exp]
23.3 0.8070

Lus10001576 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.