Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56580 70 / 9e-16 RING/U-box superfamily protein (.1.2.3) AT2G40830 67 / 1e-14 RHC1A RING-H2 finger C1A (.1.2.3) AT3G46620 42 / 6e-06 zinc finger (C3HC4-type RING finger) family protein (.1) AT3G10815 39 / 6e-05 RING/U-box superfamily protein (.1) AT1G55530 39 / 0.0001 RING/U-box superfamily protein (.1) AT5G56340 37 / 0.0004 ATCRT1 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003698 [exp] 139 / 2e-42 AT2G40830 263 / 5e-87 RING-H2 finger C1A (.1.2.3) Lus10013235 [exp] 93 / 2e-24 AT2G40830 334 / 7e-115 RING-H2 finger C1A (.1.2.3) Lus10030755 [exp] 92 / 7e-24 AT2G40830 336 / 2e-115 RING-H2 finger C1A (.1.2.3) Lus10004712 [exp] 43 / 4e-06 AT5G59550 294 / 6e-97 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10040278 [exp] 42 / 6e-06 AT5G59550 224 / 2e-71 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10024372 [exp] 40 / 4e-05 AT5G59550 197 / 5e-60 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10002637 [exp] 39 / 0.0001 AT1G55530 257 / 4e-82 RING/U-box superfamily protein (.1) Lus10013397 [exp] 39 / 0.0001 AT5G56340 330 / 5e-111 RING/U-box superfamily protein (.1) Lus10020258 [exp] 37 / 0.0006 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G032100 [exp] 92 / 4e-24 AT2G40830 327 / 1e-111 RING-H2 finger C1A (.1.2.3) Potri.016G029300 [exp] 84 / 4e-21 AT2G40830 317 / 9e-108 RING-H2 finger C1A (.1.2.3) Potri.006G087800 [exp] 45 / 4e-07 AT5G59550 258 / 1e-83 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.010G201300 [exp] 43 / 3e-06 AT2G39720 240 / 2e-75 RING-H2 finger C2A (.1) Potri.009G034800 [exp] 41 / 2e-05 AT3G46620 236 / 8e-75 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.001G243300 [exp] 41 / 2e-05 AT3G46620 239 / 8e-76 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.015G028400 [exp] 40 / 2e-05 AT3G19950 256 / 2e-83 RING/U-box superfamily protein (.1) Potri.013G060500 [exp] 40 / 2e-05 AT1G55530 207 / 2e-64 RING/U-box superfamily protein (.1) Potri.001G231000 [exp] 39 / 8e-05 AT3G60080 100 / 3e-25 RING/U-box superfamily protein (.1) Potri.001G001500 [exp] 39 / 9e-05 AT5G56340 323 / 2e-108 RING/U-box superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001583 pacid=23169288 polypeptide=Lus10001583 locus=Lus10001583.g ID=Lus10001583.BGIv1.0 annot-version=v1.0 ATGTCAAGCAGCAGAGATACGCACTGGTGCTATAGATGCAGGAGAACGGTTCAATTGAGAGAGAGATCAGAAGCAGTTTGCCCATACTGCAGTGGCGGAT TCGTCCAAGAACTTGATGAAATCAGCCTAGCCGATCCTGCAGACGACTCTGAAGGGCTTGGCAGTGAATATTTCGTCCATGACCACGTATTCGGACTAAT GGAAGCCTTTTCAGCCCTAATGAGGCAGTGA
AA sequence Show only first row Show all	>Lus10001583 pacid=23169288 polypeptide=Lus10001583 locus=Lus10001583.g ID=Lus10001583.BGIv1.0 annot-version=v1.0 MSSSRDTHWCYRCRRTVQLRERSEAVCPYCSGGFVQELDEISLADPADDSEGLGSEYFVHDHVFGLMEAFSALMRQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G56580			RING/U-box superfamily protein...		Lus10001583 [exp]	0	1
AT2G40830		RHC1A	RING-H2 finger C1A (.1.2.3)		Lus10001582 [exp]	1.4	0.8589
AT5G43950			Plant protein of unknown funct...		Lus10024955 [exp]	2.0	0.8696
AT1G50670			OTU-like cysteine protease fam...		Lus10021522 [exp]	2.0	0.8422
AT1G05170			Galactosyltransferase family p...		Lus10039657 [exp]	4.5	0.8252
AT4G35360			Uncharacterised conserved prot...		Lus10026563 [exp]	5.5	0.8105
AT1G70480			Domain of unknown function (DU...		Lus10029147 [exp]	7.3	0.8239
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10002300 [exp]	8.8	0.8231
AT2G39570		ACR9	ACT domain repeats 9, ACT doma...		Lus10004948 [exp]	13.7	0.8079
AT5G38900			Thioredoxin superfamily protei...		Lus10034369 [exp]	14.1	0.8205
AT5G49320			Protein of unknown function (D...		Lus10037723 [exp]	14.1	0.8465

Compare expression of checked genes

Lus10001583 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.