Lus10001607 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15220 184 / 3e-58 Plant basic secretory protein (BSP) family protein (.1)
AT2G15130 177 / 2e-55 Plant basic secretory protein (BSP) family protein (.1), Plant basic secretory protein (BSP) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001358 444 / 1e-160 AT2G15220 192 / 2e-61 Plant basic secretory protein (BSP) family protein (.1)
Lus10013868 311 / 3e-108 AT2G15220 217 / 3e-71 Plant basic secretory protein (BSP) family protein (.1)
Lus10026584 303 / 6e-105 AT2G15220 201 / 6e-65 Plant basic secretory protein (BSP) family protein (.1)
Lus10026585 302 / 2e-104 AT2G15220 207 / 2e-67 Plant basic secretory protein (BSP) family protein (.1)
Lus10013867 301 / 6e-104 AT2G15220 201 / 1e-64 Plant basic secretory protein (BSP) family protein (.1)
Lus10013869 286 / 5e-98 AT2G15220 209 / 5e-68 Plant basic secretory protein (BSP) family protein (.1)
Lus10001359 283 / 9e-97 AT2G15220 204 / 7e-66 Plant basic secretory protein (BSP) family protein (.1)
Lus10026586 282 / 2e-96 AT2G15220 204 / 8e-66 Plant basic secretory protein (BSP) family protein (.1)
Lus10001608 249 / 2e-84 AT2G15220 182 / 2e-58 Plant basic secretory protein (BSP) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G299500 211 / 5e-69 AT2G15220 298 / 1e-103 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094600 207 / 3e-67 AT2G15220 288 / 3e-99 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299600 203 / 9e-66 AT2G15220 277 / 6e-95 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299400 202 / 2e-65 AT2G15220 280 / 2e-96 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094500 191 / 5e-61 AT2G15220 269 / 8e-92 Plant basic secretory protein (BSP) family protein (.1)
Potri.005G202300 53 / 4e-08 AT2G42900 134 / 2e-37 Plant basic secretory protein (BSP) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0126 Peptidase_MA PF04450 BSP Peptidase of plants and bacteria
Representative CDS sequence
>Lus10001607 pacid=23175429 polypeptide=Lus10001607 locus=Lus10001607.g ID=Lus10001607.BGIv1.0 annot-version=v1.0
ATGTCTCGTCACGCATTGTTCCTCGTAGCTCTCACCGTCCTAGCGGCCACCACTGTAGCCGCCGGTGGTGAGAGTCCTGTATTGTACACCGTGACCAACA
CGGCCAACAACACTCGTGGCGGTGCTCGATTCGACACCCAGATCGGGGCCAAAATCGCCAAGGCAACAATGTATGCGGCCACGCGCTCCACGTGGGGCGT
CTTCAACTACGACACGGATCAGGGCGGATCATCGGACCGTAAGAAGATAAACTCCATCAGCCTATTCATCGACGACATGGGGGACCGCACTTTACTGGGG
AGCAAACCGGGGAAAGACGCGTCCATCCATTTAAACGCCAACTTCATCGGGAACTACACGGGGAACCTGCGGAGGCAGTTTAACGGCGTTATCTACGAGA
AGGTGGCGAGCATCTGGCAGTGGGACGCGCGTGGGCAGGCGCCAGAAGGGTTGATAACTGGGATCGCGCATTACGTGAGGCTTCGGGCGCGTTACGGGAC
GGTGGAGAAGGTGAAGCCTGGGGAAGGGGAGAGGTGGGACCAAGGGAACGGGGTTACTGCTAGGTTTCTGGCGTATTGCAATCAGCTGAAGAGAGGGTTC
GTCGGAGAACTGAATAAGAAGATGAAGTATGGGTATACTGATGGGTTCTTCGTCGACTTGCTCGGGATGCCTGTTGACCGTGTTTGGAGTAACTACAAGG
CTGAGTTCCATAAATAA
AA sequence
>Lus10001607 pacid=23175429 polypeptide=Lus10001607 locus=Lus10001607.g ID=Lus10001607.BGIv1.0 annot-version=v1.0
MSRHALFLVALTVLAATTVAAGGESPVLYTVTNTANNTRGGARFDTQIGAKIAKATMYAATRSTWGVFNYDTDQGGSSDRKKINSISLFIDDMGDRTLLG
SKPGKDASIHLNANFIGNYTGNLRRQFNGVIYEKVASIWQWDARGQAPEGLITGIAHYVRLRARYGTVEKVKPGEGERWDQGNGVTARFLAYCNQLKRGF
VGELNKKMKYGYTDGFFVDLLGMPVDRVWSNYKAEFHK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15220 Plant basic secretory protein ... Lus10001607 0 1
AT1G03700 Uncharacterised protein family... Lus10032548 2.4 0.7766
Lus10010847 11.4 0.7751
AT1G13890 ATSNAP30, SNAP3... soluble N-ethylmaleimide-sensi... Lus10037092 12.2 0.7298
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10024216 17.9 0.7534
AT3G28480 Oxoglutarate/iron-dependent ox... Lus10032184 20.7 0.7089
Lus10021782 20.7 0.7534
AT2G25470 AtRLP21 receptor like protein 21 (.1) Lus10027855 23.1 0.7534
AT3G19540 Protein of unknown function (D... Lus10028040 25.3 0.7534
AT4G18530 Protein of unknown function (D... Lus10024473 26.7 0.5410
AT3G20800 Cell differentiation, Rcd1-lik... Lus10031542 27.4 0.7534

Lus10001607 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.