Lus10001608 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15220 182 / 2e-58 Plant basic secretory protein (BSP) family protein (.1)
AT2G15130 177 / 2e-56 Plant basic secretory protein (BSP) family protein (.1), Plant basic secretory protein (BSP) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001359 392 / 2e-140 AT2G15220 204 / 7e-66 Plant basic secretory protein (BSP) family protein (.1)
Lus10013869 287 / 4e-99 AT2G15220 209 / 5e-68 Plant basic secretory protein (BSP) family protein (.1)
Lus10026586 284 / 6e-98 AT2G15220 204 / 8e-66 Plant basic secretory protein (BSP) family protein (.1)
Lus10013868 280 / 1e-96 AT2G15220 217 / 3e-71 Plant basic secretory protein (BSP) family protein (.1)
Lus10026585 273 / 1e-93 AT2G15220 207 / 2e-67 Plant basic secretory protein (BSP) family protein (.1)
Lus10026584 265 / 1e-90 AT2G15220 201 / 6e-65 Plant basic secretory protein (BSP) family protein (.1)
Lus10013867 262 / 2e-89 AT2G15220 201 / 1e-64 Plant basic secretory protein (BSP) family protein (.1)
Lus10001607 251 / 6e-85 AT2G15220 192 / 2e-61 Plant basic secretory protein (BSP) family protein (.1)
Lus10001358 247 / 2e-83 AT2G15220 192 / 2e-61 Plant basic secretory protein (BSP) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G299600 189 / 1e-60 AT2G15220 277 / 6e-95 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299500 186 / 7e-60 AT2G15220 298 / 1e-103 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094600 183 / 2e-58 AT2G15220 288 / 3e-99 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299400 178 / 1e-56 AT2G15220 280 / 2e-96 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094500 167 / 2e-52 AT2G15220 269 / 8e-92 Plant basic secretory protein (BSP) family protein (.1)
Potri.005G202300 54 / 7e-09 AT2G42900 134 / 2e-37 Plant basic secretory protein (BSP) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0126 Peptidase_MA PF04450 BSP Peptidase of plants and bacteria
Representative CDS sequence
>Lus10001608 pacid=23175432 polypeptide=Lus10001608 locus=Lus10001608.g ID=Lus10001608.BGIv1.0 annot-version=v1.0
ATGCATGCAGCCACAACCTTCACGTGGTACGTCTTCAACCAGACCGACAGCCCTTCCTTACGTAAGAACGTGAGCATCATCAGCCTAGTCGTCGAAGACA
TGCCCGAAAAGGGAAACTTCTCCTCTCCGGCAGCCCAGACGACAAATATCTCCATCCACTTAAACTCCAACTTCATCGGGAACTACACCGCCAACCTCCG
GAGGCAGTTCAACGGGATCATCTACCAGGAGATCGCAGGGATATGGCAGTGGAATGGAGACGGAAAGGCTCCGAAAGGGTTGGTCACCGGGATCGCGCAT
TACGTGAGGCTGCAGGCTCGATACGGGACGGTGGAGAAGGTGAAGCCCGGGGAAGGCGAGAGGTGGGACCAAGGGAGAGGTGTGACGGCTAGGTTTCTGG
TGTATTGTAGTCAGCTGAAGAGAGGGTTTGTCGGGGAGCTGAATAAGAAGATGAGGCATGGTTATACCGATGGGTACTTTGTTGAGTTGCTGGGGAAGTC
CGTGGAGCTTCTTTGGAGTAATTACAAGGAGAGGTACGGCCACCTGGATTCGGGGCTGATCAGTCGTCATGCATGA
AA sequence
>Lus10001608 pacid=23175432 polypeptide=Lus10001608 locus=Lus10001608.g ID=Lus10001608.BGIv1.0 annot-version=v1.0
MHAATTFTWYVFNQTDSPSLRKNVSIISLVVEDMPEKGNFSSPAAQTTNISIHLNSNFIGNYTANLRRQFNGIIYQEIAGIWQWNGDGKAPKGLVTGIAH
YVRLQARYGTVEKVKPGEGERWDQGRGVTARFLVYCSQLKRGFVGELNKKMRHGYTDGYFVELLGKSVELLWSNYKERYGHLDSGLISRHA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15220 Plant basic secretory protein ... Lus10001608 0 1
AT1G21430 YUC11 Flavin-binding monooxygenase f... Lus10000677 1.0 1.0000
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10005144 2.0 1.0000
Lus10024141 2.4 1.0000
AT5G06720 ATPA2 peroxidase 2 (.1) Lus10027988 2.8 1.0000
Lus10013255 3.2 1.0000
Lus10013259 3.5 1.0000
AT1G61110 NAC ANAC025 NAC domain containing protein ... Lus10013964 3.7 1.0000
AT3G06240 F-box family protein (.1) Lus10014136 4.0 1.0000
Lus10028570 4.2 1.0000
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10029435 4.5 1.0000

Lus10001608 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.