Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30010 145 / 5e-47 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015329 [exp] 184 / 2e-62 AT4G30010 146 / 2e-47 unknown protein Lus10001443 [exp] 183 / 3e-62 AT4G30010 146 / 2e-47 unknown protein Lus10025458 [exp] 179 / 1e-60 AT4G30010 142 / 4e-46 unknown protein Lus10001622 [exp] 103 / 5e-28 AT2G18980 320 / 4e-109 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G075600 [exp] 166 / 2e-55 AT4G30010 134 / 9e-43 unknown protein Potri.018G142500 [exp] 164 / 1e-54 AT4G30010 137 / 8e-44 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001623 pacid=23145984 polypeptide=Lus10001623 locus=Lus10001623.g ID=Lus10001623.BGIv1.0 annot-version=v1.0 ATGGCGATGAGGAGGTTCTACAGCGAGATCAAGGGGTTGAAGGTGAAGGAGCTCCCAAACCACGTGAAGCCGATGCTGTCGCTCGACTTCGTGAAGAAAT CTGTGCAGAAAGGATTGGATAATTACCACGCCAAGTACATCCTGACCAGCTCCGTCGACCCGCTCCTCCATGTCTGTTTTGGCGGGATGGCATTCTCCTA TCTCGTTGCCCTTCCCGAGGAGCGTCGCCATCTGGAGCACCAGCAGCACGCCAAAGAGCACGGCGGCCACTGA
AA sequence Show only first row Show all	>Lus10001623 pacid=23145984 polypeptide=Lus10001623 locus=Lus10001623.g ID=Lus10001623.BGIv1.0 annot-version=v1.0 MAMRRFYSEIKGLKVKELPNHVKPMLSLDFVKKSVQKGLDNYHAKYILTSSVDPLLHVCFGGMAFSYLVALPEERRHLEHQQHAKEHGGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30010			unknown protein		Lus10001623 [exp]	0	1
AT4G39400		DWF2, CBB2, BIN...	DWARF 2, CABBAGE 2, BRASSINOST...		Lus10006817 [exp]	4.9	0.6610
AT1G05460		SDE3	SILENCING DEFECTIVE, P-loop co...		Lus10017379 [exp]	6.9	0.7518
AT1G78950		ATLUP3	Terpenoid cyclases family prot...		Lus10016438 [exp]	9.2	0.6939
AT4G23840			Leucine-rich repeat (LRR) fami...		Lus10003886 [exp]	18.3	0.6767
AT5G18070		DRT101	DNA-DAMAGE-REPAIR/TOLERATION 1...		Lus10007548 [exp]	21.8	0.6667
AT4G36590	MADS		MADS-box transcription factor ...		Lus10026366 [exp]	26.8	0.5184
AT3G27030			unknown protein		Lus10012542 [exp]	32.1	0.6863
AT3G55140			Pectin lyase-like superfamily ...		Lus10003307 [exp]	33.3	0.6648
AT2G40070			unknown protein		Lus10004390 [exp]	39.5	0.6154
AT2G42450			alpha/beta-Hydrolases superfam...		Lus10024878 [exp]	45.3	0.6348

Compare expression of checked genes

Lus10001623 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.