Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18370 37 / 0.0008 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001431 [exp] 228 / 6e-79 AT2G18370 37 / 6e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001634 [exp] 94 / 6e-24 AT4G25910 260 / 7e-87 NFU domain protein 3 (.1) Lus10001432 [exp] 86 / 1e-22 AT2G18370 53 / 6e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10038427 [exp] 56 / 7e-11 AT3G51600 42 / 9e-06 lipid transfer protein 5 (.1) Lus10038428 [exp] 44 / 1e-06 ND / Lus10038429 [exp] 39 / 0.0002 AT2G18370 44 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10009630 [exp] 39 / 0.0003 AT3G51590 59 / 5e-12 lipid transfer protein 12 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001635 pacid=23145994 polypeptide=Lus10001635 locus=Lus10001635.g ID=Lus10001635.BGIv1.0 annot-version=v1.0 ATGAAGCGGAACACCTTGTTGTCTGGTTTCGTCACAATCGTTATATTCACCGTCGCTATTCTGATAGGAATTAGCGACGGGTACACGTGGCCACCGAAGT GCGCCGGTTACCGAAAAGCATCCAAGAGCTGCCTTCTCTACGTCAATGGAAACGTAACGGATATCCCCGAAGAGTGCTGCCCTACACTGAAAACCTATCT AGCACCCGCCAAGGATGATTCCACGAAGAAGAAAGCCGCATGCTATTGCATCTCCGACTTCGCCCACGGCGGCAAATACGACAAAGGTCGGGCCAAGGAT GTTCTCAAGGAGTGTGAATTCCCCATCCCGCCCTCCTTCTTCGACTGCCGCACGTAA
AA sequence Show only first row Show all	>Lus10001635 pacid=23145994 polypeptide=Lus10001635 locus=Lus10001635.g ID=Lus10001635.BGIv1.0 annot-version=v1.0 MKRNTLLSGFVTIVIFTVAILIGISDGYTWPPKCAGYRKASKSCLLYVNGNVTDIPEECCPTLKTYLAPAKDDSTKKKAACYCISDFAHGGKYDKGRAKD VLKECEFPIPPSFFDCRT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10001635 [exp]	0	1

Compare expression of checked genes

Lus10001635 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.