Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41685 85 / 9e-24 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) AT1G64220 79 / 4e-21 TOM7-2 translocase of outer membrane 7 kDa subunit 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000059 [exp] 103 / 8e-31 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10016473 [exp] 103 / 8e-31 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10040758 [exp] 102 / 1e-30 AT5G41685 88 / 7e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10007843 [exp] 95 / 8e-28 AT5G41685 85 / 5e-24 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10004754 [exp] 94 / 4e-27 AT5G41685 81 / 3e-22 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G146602 [exp] 109 / 1e-33 AT5G41685 78 / 9e-21 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Potri.006G077500 [exp] 108 / 4e-33 AT5G41685 75 / 1e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Potri.018G145502 [exp] 106 / 4e-32 AT5G41685 74 / 2e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08038 [flax] [poplar] Tom7 TOM7 family
Representative CDS sequence Show only first row Show all	>Lus10001641 pacid=23145990 polypeptide=Lus10001641 locus=Lus10001641.g ID=Lus10001641.BGIv1.0 annot-version=v1.0 ATGGCGTCTAGGGTTGCGCTGAAGACGAAGGGGAAGAGCAGCAAAGGAGACAGAGGCGGCGAGGCGAAATCGAAGAAGGAGAGCTTGAAGGAGTGGGCCG ATTGGAGTTTACACAAGGCCAAAGTCATCACTCACTACGGCTTCATCCCTCTCATCATCGTGATCGGCATGAACTCCGAGCCCAAGCCTCAGCTCTACCA GCTCCTCAGCCCCGTTTGA
AA sequence Show only first row Show all	>Lus10001641 pacid=23145990 polypeptide=Lus10001641 locus=Lus10001641.g ID=Lus10001641.BGIv1.0 annot-version=v1.0 MASRVALKTKGKSSKGDRGGEAKSKKESLKEWADWSLHKAKVITHYGFIPLIIVIGMNSEPKPQLYQLLSPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41685			Mitochondrial outer membrane t...		Lus10001641 [exp]	0	1
AT2G21290			unknown protein		Lus10018053 [exp]	1.7	0.8160
AT4G18372			Small nuclear ribonucleoprotei...		Lus10000241 [exp]	5.0	0.7692
AT2G20940			Protein of unknown function (D...		Lus10034474 [exp]	7.9	0.7575
AT2G20540		MEF21	mitochondrial editing factor ...		Lus10004663 [exp]	9.4	0.7184
AT2G36930	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10023928 [exp]	9.7	0.7791
AT3G59520		ATRBL13	RHOMBOID-like protein 13 (.1)		Lus10008156 [exp]	12.0	0.7552
AT4G05530		SDRA, IBR1	SHORT-CHAIN DEHYDROGENASE/REDU...		Lus10015542 [exp]	14.1	0.7762
					Lus10039242 [exp]	15.2	0.6970
AT1G27350			Ribosome associated membrane p...		Lus10037031 [exp]	15.9	0.7427
AT1G76060		EMB1793	EMBRYO DEFECTIVE 1793, LYR fam...		Lus10005621 [exp]	16.8	0.7784

Compare expression of checked genes

Lus10001641 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.