Lus10001659 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48020 52 / 2e-08 ATPMEI1 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
AT3G17220 45 / 3e-06 ATPMEI2 pectin methylesterase inhibitor 2 (.1)
AT5G46960 41 / 0.0001 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001658 142 / 4e-43 AT1G48020 86 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Lus10017347 140 / 2e-42 AT3G17220 81 / 2e-19 pectin methylesterase inhibitor 2 (.1)
Lus10017345 136 / 6e-41 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1)
Lus10017346 105 / 1e-28 AT3G17220 79 / 8e-19 pectin methylesterase inhibitor 2 (.1)
Lus10041650 100 / 1e-26 AT1G48020 85 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Lus10023114 53 / 8e-09 AT3G17220 60 / 2e-11 pectin methylesterase inhibitor 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G044100 48 / 5e-07 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G086500 40 / 0.0004 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10001659 pacid=23154056 polypeptide=Lus10001659 locus=Lus10001659.g ID=Lus10001659.BGIv1.0 annot-version=v1.0
ATGTCAATTTCAAAAGCGACCTCATTCTTGTTCCTCCTTATCACGGTTTTCTTCCTCCTATCCCAGACCCTTCCTCATGTCGCCGCGTTAGCCCCACCGG
AGATCGTCGAGATATGTGCCAAGAGCATCGAAAAGACCCTCTGCAACGACTTCCTCAAGAATATGCCCGGCATGAAGACTGCCAACTTCAAGACCGCCGG
TCTCATCACCCTGGACTCCGTGCGTGACCACGTCATCGAGACGGCGGTAAACATTGCCGACTTGCTTGGGGGTTTTTTCGTGGACCCCAAGACGAACGGG
ACCTACAAGTCGTGCCTGATAAGCTACTATGATGCTGCAAAAGACATCGCGACGACCACAATATCGCTGAACATCGACGACTACAATGGCGCTAACATCC
AGGCGTCGGCAGCTCAGGATAAGGTTAAGCATTGCTACGATGGCGTCAAGCAGGGAAGTACTCAGCCGGGAATTGAACTGAAAAGGGGTGTCACGTTCGA
TATTAGTCTTATTGATCTCGTTTTGATCATCACCAACAAATTGCTCGGAAAATGA
AA sequence
>Lus10001659 pacid=23154056 polypeptide=Lus10001659 locus=Lus10001659.g ID=Lus10001659.BGIv1.0 annot-version=v1.0
MSISKATSFLFLLITVFFLLSQTLPHVAALAPPEIVEICAKSIEKTLCNDFLKNMPGMKTANFKTAGLITLDSVRDHVIETAVNIADLLGGFFVDPKTNG
TYKSCLISYYDAAKDIATTTISLNIDDYNGANIQASAAQDKVKHCYDGVKQGSTQPGIELKRGVTFDISLIDLVLIITNKLLGK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48020 ATPMEI1 ARABIDOPSIS THALIANA PECTIN ME... Lus10001659 0 1
AT1G21430 YUC11 Flavin-binding monooxygenase f... Lus10000677 6.6 0.9699
AT4G16050 Aminotransferase-like, plant m... Lus10043051 7.9 0.8585
AT2G15220 Plant basic secretory protein ... Lus10001608 9.4 0.9699
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10005144 11.5 0.9699
AT3G50150 Plant protein of unknown funct... Lus10005799 13.3 0.9699
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10009630 14.8 0.9699
Lus10011605 16.2 0.9699
Lus10024141 17.5 0.9699
Lus10025268 18.8 0.9699
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10026232 19.9 0.9699

Lus10001659 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.