Plant FIBer expression Database

Lus10001686 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00680 117 / 3e-33 ATCG00680.1, PSBB photosystem II reaction center protein B (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006593
[exp]
117 / 3e-35 ATCG00680 352 / 1e-121 photosystem II reaction center protein B (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G074868
[exp]
116 / 9e-33 ATCG00680 926 / 0.0 photosystem II reaction center protein B (.1)
Potri.011G113575
[exp]
114 / 1e-31 ATCG00680 933 / 0.0 photosystem II reaction center protein B (.1)
Potri.017G140700
[exp]
111 / 2e-31 ATCG00680 634 / 0.0 photosystem II reaction center protein B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00421 PSII Photosystem II protein
Representative CDS sequence
>Lus10001686 pacid=23144372 polypeptide=Lus10001686 locus=Lus10001686.g ID=Lus10001686.BGIv1.0 annot-version=v1.0
ATGGTTGAATTTTATGGTGGCGAACTAAATGGAGTCAGTTATAGTGATCCTACTACTGTGAAAAAATATGCTAGACGCGCTCAATTGGGTGAAATTTTTG
AATTAGATCGTGCTACTTTGAAATCCGATGGTGTTTTTCGTAGTAGTCCAAGGGGCTGGTTTACTTTTGGACATGGTTAG
AA sequence
>Lus10001686 pacid=23144372 polypeptide=Lus10001686 locus=Lus10001686.g ID=Lus10001686.BGIv1.0 annot-version=v1.0
MVEFYGGELNGVSYSDPTTVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Lus10001686
[exp]
0 1
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Lus10006593
[exp]
1.0 0.9970
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Lus10006594
[exp]
2.0 0.9931
AT3G63380 ATPase E1-E2 type family prote... Lus10004087
[exp]
4.2 0.8839
ATCG00490 ATCG00490.1, RB... ribulose-bisphosphate carboxyl... Lus10032825
[exp]
4.2 0.9548
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Lus10032827
[exp]
4.9 0.9519
ATCG00120 ATCG00120.1, AT... ATP synthase subunit alpha (.1... Lus10004894
[exp]
5.9 0.9471
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Lus10009173
[exp]
6.0 0.9460
AT3G02360 6-phosphogluconate dehydrogena... Lus10029098
[exp]
7.0 0.7645
ATCG01280 ATCG01280.1, YC... Chloroplast Ycf2;ATPase, AAA t... Lus10007142
[exp]
7.2 0.8461
AT1G21400 Thiamin diphosphate-binding fo... Lus10000772
[exp]
7.4 0.8702

Lus10001686 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.