Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15580 62 / 4e-13 RING/U-box superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030120 [exp] 67 / 2e-14 AT2G15580 139 / 2e-41 RING/U-box superfamily protein (.1.2) Lus10001685 [exp] 57 / 1e-10 AT2G15580 131 / 2e-38 RING/U-box superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G114500 [exp] 73 / 6e-17 AT2G15580 161 / 3e-50 RING/U-box superfamily protein (.1.2) Potri.006G190300 [exp] 70 / 2e-15 AT2G15580 170 / 2e-53 RING/U-box superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001688 pacid=23144376 polypeptide=Lus10001688 locus=Lus10001688.g ID=Lus10001688.BGIv1.0 annot-version=v1.0 ATGGCAGGGATGTTGGCCGGTGTTGAATGCGCCCGGAGAAGACGGTTCCACGGAAGCGGCGGCGACAATTTCTCCGGCGAGATCCGAAGGCCATCATCAT TTTGTTTGTATCCCAGCAATCATGAAGCCTCAGGCTCCTTTGCCGCGGTAGCATCTGAGAGAATAATACAGTCTGAAGCGTATGATGACGAGAGGCTAGA AGATTCAGCCAGGGAAGCCAAGGAGAGACTTGACGAGAGGCTTAGATTACAGAGGAGATCGTTTGATACCAAAAGGTCCCCAAGGACTGACATGAATTCT TCCACTCCTTCAGAAAAGGATGGAGCTAAGTCTTCGAGGCTGGGGAAGTTGAGGGCGATGAAATTGAAGCGGTGGCTGAGCGCCCAGTAA
AA sequence Show only first row Show all	>Lus10001688 pacid=23144376 polypeptide=Lus10001688 locus=Lus10001688.g ID=Lus10001688.BGIv1.0 annot-version=v1.0 MAGMLAGVECARRRRFHGSGGDNFSGEIRRPSSFCLYPSNHEASGSFAAVASERIIQSEAYDDERLEDSAREAKERLDERLRLQRRSFDTKRSPRTDMNS STPSEKDGAKSSRLGKLRAMKLKRWLSAQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G15580			RING/U-box superfamily protein...		Lus10001688 [exp]	0	1
AT1G53400			Ubiquitin domain-containing pr...		Lus10007315 [exp]	3.2	0.8292
AT5G57580			Calmodulin-binding protein (.1...		Lus10018437 [exp]	4.7	0.8103
AT1G27290			unknown protein		Lus10037037 [exp]	6.3	0.7809
AT1G76390		PUB43	plant U-box 43, ARM repeat sup...		Lus10030734 [exp]	11.5	0.7659
AT5G07580	AP2_ERF		Integrase-type DNA-binding sup...		Lus10042995 [exp]	12.8	0.7609
					Lus10023083 [exp]	13.0	0.7292
AT3G45640		ATMAPK3, ATMPK3	mitogen-activated protein kina...		Lus10018127 [exp]	14.1	0.8019
AT5G22920			CHY-type/CTCHY-type/RING-type ...		Lus10023914 [exp]	17.0	0.7530
AT3G29000			Calcium-binding EF-hand family...		Lus10019090 [exp]	18.3	0.7734
AT5G45110		ATNPR3, NPR3	NPR1-like protein 3 (.1)		Lus10036200 [exp]	20.0	0.7911

Compare expression of checked genes

Lus10001688 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.