Lus10001689 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26580 39 / 8e-05 MADS AGL34 AGAMOUS-like-34 (.1)
AT1G65330 38 / 0.0001 MADS AGL37, PHE1 PHERES1, AGAMOUS-like 37, MADS-box transcription factor family protein (.1)
AT1G22590 36 / 0.0004 MADS AGL87 AGAMOUS-like 87 (.1.2)
AT5G27810 35 / 0.001 MADS MADS-box transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004459 101 / 3e-30 AT5G27810 46 / 6e-08 MADS-box transcription factor family protein (.1)
Lus10000400 96 / 8e-28 ND 42 / 3e-06
Lus10014883 71 / 2e-16 AT5G48670 114 / 1e-29 AGAMOUS-like 80 (.1)
Lus10022325 70 / 4e-16 AT1G65300 113 / 1e-30 PHERES2, AGAMOUS-like 38 (.1)
Lus10022316 69 / 5e-16 AT5G48670 131 / 2e-36 AGAMOUS-like 80 (.1)
Lus10022107 65 / 4e-15 ND 71 / 6e-16
Lus10007713 61 / 2e-13 AT1G65330 74 / 1e-16 PHERES1, AGAMOUS-like 37, MADS-box transcription factor family protein (.1)
Lus10007711 60 / 3e-13 AT5G48670 83 / 5e-20 AGAMOUS-like 80 (.1)
Lus10022100 45 / 7e-08 ND 37 / 7e-08
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G002400 44 / 1e-06 AT5G48670 222 / 4e-71 AGAMOUS-like 80 (.1)
Potri.013G107600 38 / 0.0001 AT1G22590 117 / 9e-34 AGAMOUS-like 87 (.1.2)
Potri.001G329800 36 / 0.0005 AT5G55690 64 / 2e-11 MADS-box transcription factor family protein (.1)
Potri.012G109900 36 / 0.0007 AT5G55690 112 / 2e-28 MADS-box transcription factor family protein (.1)
PFAM info
Representative CDS sequence
>Lus10001689 pacid=23174706 polypeptide=Lus10001689 locus=Lus10001689.g ID=Lus10001689.BGIv1.0 annot-version=v1.0
ATGAAGAGGAAGAGCAGGCTAATGAAGAAAGTGAAGGAGCTGAGAACTCTCAAAGGCATCCAAGCCTGCACCATTGTCAACAACCGGTACGATGAGGCGC
AACCGTCGGAGACTTGGACGCCGATGCTAGACGGGGTCCACCATGTTCTACCCCGCATTAAGAATATGCCCAAGATGAACCAGAACAAGAATATGGTCAA
CTAG
AA sequence
>Lus10001689 pacid=23174706 polypeptide=Lus10001689 locus=Lus10001689.g ID=Lus10001689.BGIv1.0 annot-version=v1.0
MKRKSRLMKKVKELRTLKGIQACTIVNNRYDEAQPSETWTPMLDGVHHVLPRIKNMPKMNQNKNMVN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G27810 MADS MADS-box transcription factor ... Lus10001689 0 1

Lus10001689 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.