Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55460 137 / 7e-41 C2H2ZnF DNA/RNA-binding protein Kin17, conserved region (.1) AT5G51795 134 / 7e-40 DNA/RNA-binding protein Kin17, conserved region (.1) AT4G08350 38 / 0.0002 GTA2, GTA02 global transcription factor group A2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005161 [exp] 153 / 8e-47 AT1G55460 596 / 0.0 DNA/RNA-binding protein Kin17, conserved region (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G204900 [exp] 145 / 1e-43 AT1G55460 561 / 0.0 DNA/RNA-binding protein Kin17, conserved region (.1) Potri.008G055300 [exp] 143 / 4e-43 AT1G55460 546 / 0.0 DNA/RNA-binding protein Kin17, conserved region (.1) Potri.009G124200 [exp] 37 / 0.0006 AT4G08350 1372 / 0.0 global transcription factor group A2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001696 pacid=23171919 polypeptide=Lus10001696 locus=Lus10001696.g ID=Lus10001696.BGIv1.0 annot-version=v1.0 ATGCTTGAGGGTAAGCATCGGTTAAGGGTTGATCAGGTTGAGCTTGAGACGGTCATACCTCAGATTGGAGGTTTGGTGAAGATAGTGAATGGAGCATATA GAGGGTCTAATGCAAGGCTTTTGGGAGTTGACACCGATAACTTTTGCGCCAAGGTGCGGATAGAGAAGGGGATTTACGACGGCAGAGTGCTTAAGGCTAT AGAATACGAGGACATATGCAAACTTGCCTGA
AA sequence Show only first row Show all	>Lus10001696 pacid=23171919 polypeptide=Lus10001696 locus=Lus10001696.g ID=Lus10001696.BGIv1.0 annot-version=v1.0 MLEGKHRLRVDQVELETVIPQIGGLVKIVNGAYRGSNARLLGVDTDNFCAKVRIEKGIYDGRVLKAIEYEDICKLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55460	C2H2ZnF		DNA/RNA-binding protein Kin17,...		Lus10001696 [exp]	0	1
AT1G74250			DNAJ heat shock N-terminal dom...		Lus10017846 [exp]	1.0	0.9012
AT1G55460	C2H2ZnF		DNA/RNA-binding protein Kin17,...		Lus10005161 [exp]	1.4	0.8884
AT1G26550			FKBP-like peptidyl-prolyl cis-...		Lus10015714 [exp]	3.0	0.8521
					Lus10014600 [exp]	5.5	0.8288
AT2G35900			unknown protein		Lus10021249 [exp]	7.2	0.8323
AT3G20890			RNA-binding (RRM/RBD/RNP motif...		Lus10030139 [exp]	7.7	0.8070
AT3G24490	Trihelix		Alcohol dehydrogenase transcri...		Lus10033094 [exp]	10.5	0.7830
					Lus10032068 [exp]	11.5	0.8060
AT5G40570			Surfeit locus protein 2 (SURF2...		Lus10003658 [exp]	13.1	0.7642
AT3G24730			mRNA splicing factor, thioredo...		Lus10022811 [exp]	13.5	0.7473

Compare expression of checked genes

Lus10001696 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.