Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005160 [exp] 117 / 1e-31 AT3G12590 1536 / 0.0 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G207900 [exp] 62 / 3e-12 AT3G12590 1504 / 0.0 unknown protein Potri.008G052700 [exp] 42 / 3e-05 AT3G12590 1518 / 0.0 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001700 pacid=23171918 polypeptide=Lus10001700 locus=Lus10001700.g ID=Lus10001700.BGIv1.0 annot-version=v1.0 ATGACTTCGTCGGCCTTCAGTCCATCGCGGGGCAGTCCGGTCAGCTCCAGGTTACAGAGGGAACAACACTTTGTTCTAATCGGCAGCAACAGGCTGAGAT CCTCTTCGCTTAGGAAGCCGCCGGAGCCTTTGCGGAGAGCAATTGCGGACTGTCTGTCGTCTTCCGCCTCGGCTTCGGCGTCTTCTGGTGGTAGTGTGGT CGCCGTCTTGCACCATGGCAGTCCGTCCGTAGCGCTGAACGAAGCTTCGAGGACTCTACGTGTGAGTAATTGCTTTTGCCTATATGCTCTCTCTAGGTGT TGTGTTTTCTTTTCCTAA
AA sequence Show only first row Show all	>Lus10001700 pacid=23171918 polypeptide=Lus10001700 locus=Lus10001700.g ID=Lus10001700.BGIv1.0 annot-version=v1.0 MTSSAFSPSRGSPVSSRLQREQHFVLIGSNRLRSSSLRKPPEPLRRAIADCLSSSASASASSGGSVVAVLHHGSPSVALNEASRTLRVSNCFCLYALSRC CVFFS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12590			unknown protein		Lus10001700 [exp]	0	1
AT4G28760			Protein of unknown function (D...		Lus10011912 [exp]	24.2	0.8264
AT3G10370		SDP6	SUGAR-DEPENDENT 6, FAD-depende...		Lus10013468 [exp]	24.9	0.8196
AT1G14100		FUT8	fucosyltransferase 8 (.1)		Lus10041641 [exp]	38.5	0.8148
AT4G39080		VHA-A3	vacuolar proton ATPase A3 (.1)		Lus10017490 [exp]	41.7	0.8137
AT1G64760			O-Glycosyl hydrolases family 1...		Lus10020261 [exp]	43.0	0.7803
AT1G55325		MAB2, GCT	MACCHI-BOU 2, GRAND CENTRAL, R...		Lus10016684 [exp]	53.0	0.8077
AT3G18290		BTS, EMB2454	embryo defective 2454, BRUTUS,...		Lus10034346 [exp]	59.7	0.7922
AT4G28760			Protein of unknown function (D...		Lus10022843 [exp]	60.0	0.7887
AT5G05170		IXR1, CEV1, ATH...	ISOXABEN RESISTANT 1, CONSTIT...		Lus10012198 [exp]	60.4	0.7845
AT4G31340			myosin heavy chain-related (.1...		Lus10036424 [exp]	87.0	0.7600

Compare expression of checked genes

Lus10001700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.