Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33355 86 / 7e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G18370 79 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G59310 72 / 2e-17 LTP4 lipid transfer protein 4 (.1) AT5G59320 67 / 2e-15 LTP3 lipid transfer protein 3 (.1) AT2G15050 67 / 2e-15 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G51590 67 / 2e-15 LTP12 lipid transfer protein 12 (.1) AT3G51600 60 / 1e-12 LTP5 lipid transfer protein 5 (.1) AT2G38540 59 / 3e-12 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G01870 56 / 3e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G38530 55 / 8e-11 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005156 [exp] 193 / 2e-59 AT3G55400 931 / 0.0 OVULE ABORTION 1, methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.1), methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.2) Lus10040917 [exp] 141 / 5e-40 AT4G01030 898 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10029445 [exp] 129 / 7e-40 AT4G33355 103 / 2e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10009813 [exp] 124 / 5e-34 AT4G01030 820 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10026418 [exp] 76 / 1e-18 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10015279 [exp] 74 / 4e-18 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10015278 [exp] 72 / 2e-17 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10025151 [exp] 69 / 3e-16 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10025231 [exp] 69 / 8e-16 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G046500 [exp] 110 / 1e-32 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.004G086600 [exp] 71 / 4e-17 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 71 / 7e-17 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232900 [exp] 67 / 1e-15 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 67 / 2e-15 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G136000 [exp] 64 / 3e-14 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135700 [exp] 64 / 5e-14 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.016G135800 [exp] 62 / 2e-13 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.011G021900 [exp] 61 / 3e-13 AT3G08770 60 / 8e-13 lipid transfer protein 6 (.1.2) Potri.009G025200 [exp] 60 / 1e-12 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10001703 pacid=23171910 polypeptide=Lus10001703 locus=Lus10001703.g ID=Lus10001703.BGIv1.0 annot-version=v1.0 ATGAGGGGAGCATCAATCATTTCCATGTTGGCTATATTGGCAACTATCCAATTCATTGTTAAGCCAGGGGATGCTCCCATAGGTTGTGGCCAAGTGGACT CCTACTTGGCGCCTTGCATTCCATACTTGACCACAGGAAACGGAGACCCTGCCCCAAAATGCTGTGAGGGAATCCAGAGCTTGAAGGCCAACACTTCCAC CGTTGATGATCGGAGAGCAGTGTGTGCCTGTGTCAAAGACGCCGCTAACCGCTACCCGGTGAAGGATGTTGCTGCTTCCTCTCTCCCTACCAAATGTGGT GTTCCTATCACCATCCCTATCTCCAAGGCTATCAACTGGCAGACGTAA
AA sequence Show only first row Show all	>Lus10001703 pacid=23171910 polypeptide=Lus10001703 locus=Lus10001703.g ID=Lus10001703.BGIv1.0 annot-version=v1.0 MRGASIISMLAILATIQFIVKPGDAPIGCGQVDSYLAPCIPYLTTGNGDPAPKCCEGIQSLKANTSTVDDRRAVCACVKDAANRYPVKDVAASSLPTKCG VPITIPISKAINWQT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33355			Bifunctional inhibitor/lipid-t...		Lus10001703 [exp]	0	1
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10022081 [exp]	5.8	0.6507
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Lus10022927 [exp]	7.6	0.6451
					Lus10013473 [exp]	17.9	0.6319
AT3G28860		ABCB19, ATMDR11...	P-GLYCOPROTEIN 19, MULTIDRUG R...		Lus10015595 [exp]	18.2	0.6362
AT5G18910			Protein kinase superfamily pro...		Lus10012776 [exp]	21.2	0.6069
					Lus10021186 [exp]	25.8	0.6280
AT2G34930			disease resistance family prot...		Lus10000236 [exp]	29.5	0.6228
AT2G39570		ACR9	ACT domain repeats 9, ACT doma...		Lus10001702 [exp]	39.0	0.5452
AT2G13620		ATCHX15	CATION/H+ EXCHANGER 15, cation...		Lus10030013 [exp]	42.0	0.5948
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Lus10001465 [exp]	43.0	0.5986

Compare expression of checked genes

Lus10001703 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.