Lus10001706 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G55400 117 / 1e-31 OVA1 OVULE ABORTION 1, methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.1), methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001704 191 / 5e-59 AT3G55400 891 / 0.0 OVULE ABORTION 1, methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.1), methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.2)
Lus10005156 166 / 4e-49 AT3G55400 931 / 0.0 OVULE ABORTION 1, methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.1), methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G207300 123 / 5e-34 AT3G55400 935 / 0.0 OVULE ABORTION 1, methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.1), methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.2)
PFAM info
Representative CDS sequence
>Lus10001706 pacid=23171906 polypeptide=Lus10001706 locus=Lus10001706.g ID=Lus10001706.BGIv1.0 annot-version=v1.0
ATGGGGATTTTGGTTGACCAGTTGAGTGATGTGAAACAGGATCTTGTAATTATTCTGGAAGCAATGAGGATCATAGCCATTGTGTTATCACCTGTAGCAC
CACGGTTGAGCTGCAGAATATATACACAGCTCGGCTACTCGGAGGACCAATTTGCAACTGTGACATGGGGAGAGACAAAGTGGGGTGGGTTGAAAGGTGG
TCAAGTGATGGGTCAACCTAGTCCTGTGTTTGCGAGGATTGAGAACCCAGCAGAAGTAGAAGCTGGTTCTTCTGACGCATCAGCAGCAGCTAAGCCGCAG
TTGAAAAGCAAGAAGCAAAAGAAGAAACCTCAGCCACAAGTAGCTGCTGAGGCTTAG
AA sequence
>Lus10001706 pacid=23171906 polypeptide=Lus10001706 locus=Lus10001706.g ID=Lus10001706.BGIv1.0 annot-version=v1.0
MGILVDQLSDVKQDLVIILEAMRIIAIVLSPVAPRLSCRIYTQLGYSEDQFATVTWGETKWGGLKGGQVMGQPSPVFARIENPAEVEAGSSDASAAAKPQ
LKSKKQKKKPQPQVAAEA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G55400 OVA1 OVULE ABORTION 1, methionyl-tR... Lus10001706 0 1
AT5G59600 Tetratricopeptide repeat (TPR)... Lus10040779 2.8 0.6621
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10042099 5.8 0.6219
AT4G10265 Wound-responsive family protei... Lus10039760 9.6 0.6606
AT2G31420 B3 Domain of unknown function (DU... Lus10009354 15.0 0.6594
AT5G40830 ATRAD3, ATATR S-adenosyl-L-methionine-depend... Lus10007588 15.4 0.6677
AT2G21950 SKIP6 SKP1 interacting partner 6 (.1... Lus10030883 15.9 0.6557
Lus10021285 20.2 0.6318
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10016490 21.5 0.6615
AT3G26010 Galactose oxidase/kelch repeat... Lus10003692 23.2 0.6255
Lus10038177 31.5 0.6168

Lus10001706 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.