Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G26055 72 / 3e-18 unknown protein AT5G57080 61 / 9e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011865 [exp] 140 / 1e-44 AT4G26055 68 / 2e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G204200 [exp] 78 / 1e-20 AT4G26055 76 / 1e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001708 pacid=23171922 polypeptide=Lus10001708 locus=Lus10001708.g ID=Lus10001708.BGIv1.0 annot-version=v1.0 ATGAACAAGAAATTTGGAGCAGGGAAGCCTCCAACAGGGACTCCTTCACTTGGGTGGTCATGTGTGGTGGTCATTATTTCTCTTCTCTCTGGTGCCTCTA TTGTCCACAATATCTACAAACCTGATCTTGTAAGGCCTATTCCCATTATGGCTTCTGCTTTGGCCTTGGAAACATTTGCTCACGATGTGTTCCATATAGT GCTTGACTTACTGAAAACTTTCTTGAATCCTGGAACTGTGCAGAGGTTGCCTGCGGTGGAGAATGTCGACACTGGTGACAAGGATGAAGTCCGGTCCCAG TAG
AA sequence Show only first row Show all	>Lus10001708 pacid=23171922 polypeptide=Lus10001708 locus=Lus10001708.g ID=Lus10001708.BGIv1.0 annot-version=v1.0 MNKKFGAGKPPTGTPSLGWSCVVVIISLLSGASIVHNIYKPDLVRPIPIMASALALETFAHDVFHIVLDLLKTFLNPGTVQRLPAVENVDTGDKDEVRSQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G26055			unknown protein		Lus10001708 [exp]	0	1
AT4G26055			unknown protein		Lus10011865 [exp]	1.0	0.6952
AT1G07210			Ribosomal protein S18 (.1)		Lus10039100 [exp]	2.8	0.6766
AT4G14455		ATBS14B ,ATBET1...	ARABIDOPSIS THALIANA BET1P/SFT...		Lus10021879 [exp]	11.2	0.6441
AT2G38280		ATAMPD, FAC1	EMBRYONIC FACTOR1, ADENOSINE 5...		Lus10005043 [exp]	15.3	0.6750
AT3G62810			complex 1 family protein / LVR...		Lus10021599 [exp]	27.7	0.6497
AT5G09225			unknown protein		Lus10020870 [exp]	31.5	0.6514
AT1G02100		SBI1	SUPPRESSOR OF BRI1, Leucine ca...		Lus10042909 [exp]	32.6	0.5174
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Lus10029234 [exp]	33.6	0.6024
AT1G12400			Nucleotide excision repair, TF...		Lus10007001 [exp]	35.3	0.5791
AT3G15395			unknown protein		Lus10039067 [exp]	39.5	0.5850

Compare expression of checked genes

Lus10001708 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.