Lus10001722 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033828 70 / 1e-14 AT5G27230 150 / 2e-36 Frigida-like protein (.1)
Lus10009979 57 / 4e-10 AT5G48385 107 / 5e-24 FRIGIDA-like protein (.1)
Lus10038038 54 / 3e-09 AT5G48385 102 / 2e-22 FRIGIDA-like protein (.1)
Lus10004132 0 / 1 AT5G48385 89 / 2e-18 FRIGIDA-like protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G044000 47 / 1e-06 AT5G27230 125 / 2e-29 Frigida-like protein (.1)
Potri.005G043900 45 / 4e-06 AT5G27230 119 / 3e-27 Frigida-like protein (.1)
Potri.005G044100 40 / 0.0001 AT5G27230 116 / 1e-26 Frigida-like protein (.1)
Potri.005G044200 40 / 0.0003 AT5G27220 129 / 5e-30 Frigida-like protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07899 Frigida Frigida-like protein
Representative CDS sequence
>Lus10001722 pacid=23142975 polypeptide=Lus10001722 locus=Lus10001722.g ID=Lus10001722.BGIv1.0 annot-version=v1.0
ATGTCCCCCCATGTTAAGCCACATGTCGAGAGAGAAACCTTCAGCTTTGCAAAGAACTGGAAATCCAAGCTTGCTGGTGTGAAGGGTCATTTCATCGAAG
CCGTCTGTTTCTTACTATTCTTAGCTGCATACAAATTGGTAATTCATTTCGACAGAGACGACCTTTCGTGTGTTGTCCGTATTCCGACTAAACCATTCCA
GATTCTTGCCTTCAACAATTATACCCCAAATAGACGTATCTCAGCACATCCCGTCCTGCACCATCCGATCCAACCATGTCTTGTTCTTCTTCTTCTTCAC
TGGCTGCCCCTGACAAAAATACTCGTAAGCATTGCAGGGTGGCAGACGAAGCGCGAGAAATGCCAGGGTCCAACACGACATTCTGGCCTCCACAACATCA
TTTGA
AA sequence
>Lus10001722 pacid=23142975 polypeptide=Lus10001722 locus=Lus10001722.g ID=Lus10001722.BGIv1.0 annot-version=v1.0
MSPHVKPHVERETFSFAKNWKSKLAGVKGHFIEAVCFLLFLAAYKLVIHFDRDDLSCVVRIPTKPFQILAFNNYTPNRRISAHPVLHHPIQPCLVLLLLH
WLPLTKILVSIAGWQTKREKCQGPTRHSGLHNII

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001722 0 1
AT3G58760 Integrin-linked protein kinase... Lus10037851 5.0 0.8683
AT3G05480 ATRAD9 cell cycle checkpoint control ... Lus10029894 12.0 0.8304
AT5G49180 Plant invertase/pectin methyle... Lus10023775 14.5 0.7573
AT3G48540 Cytidine/deoxycytidylate deami... Lus10016755 20.9 0.7564
AT2G42840 PDF1 protodermal factor 1 (.1) Lus10007351 21.8 0.8366
AT1G22590 MADS AGL87 AGAMOUS-like 87 (.1.2) Lus10023294 23.1 0.8338
Lus10038266 26.7 0.8294
AT3G52610 unknown protein Lus10014215 29.7 0.8308
AT5G51800 Trihelix Protein kinase superfamily pro... Lus10031672 32.6 0.8330
AT1G05950 unknown protein Lus10005129 34.5 0.8205

Lus10001722 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.