Lus10001727 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08845 268 / 8e-93 Ribosomal L18p/L5e family protein (.1.2)
AT3G20230 107 / 1e-29 Ribosomal L18p/L5e family protein (.1)
AT3G22450 91 / 4e-22 Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004129 374 / 6e-124 AT5G27240 265 / 4e-82 DNAJ heat shock N-terminal domain-containing protein (.1)
Lus10020797 116 / 1e-32 AT3G20230 238 / 1e-80 Ribosomal L18p/L5e family protein (.1)
Lus10007379 116 / 1e-32 AT3G20230 234 / 3e-79 Ribosomal L18p/L5e family protein (.1)
Lus10006115 115 / 4e-31 AT3G22450 231 / 6e-74 Ribosomal L18p/L5e family protein (.1)
Lus10010558 114 / 1e-30 AT3G22450 238 / 8e-77 Ribosomal L18p/L5e family protein (.1)
Lus10021433 38 / 0.001 AT3G45020 200 / 8e-68 Ribosomal L18p/L5e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G029300 303 / 1e-106 AT1G08845 295 / 1e-102 Ribosomal L18p/L5e family protein (.1.2)
Potri.013G108700 116 / 6e-33 AT3G20230 226 / 6e-76 Ribosomal L18p/L5e family protein (.1)
Potri.019G081000 117 / 7e-33 AT3G20230 249 / 4e-85 Ribosomal L18p/L5e family protein (.1)
Potri.008G153100 112 / 1e-29 AT3G22450 253 / 2e-82 Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Lus10001727 pacid=23142982 polypeptide=Lus10001727 locus=Lus10001727.g ID=Lus10001727.BGIv1.0 annot-version=v1.0
ATGTTGAAGCAGGCGCTTGGGAAAGTACTGGTCAGAGAAGTTTTGACAAGTTCAATCAGCAAGCTTGGACCTTTCTCAAATGCTGCCATTAATGGCTTCC
ACACTGGACAGGCACACAATGCCCCGAGAAGCTTCTTCGGGGTAGAGGACTTCCTGGACGACGACAACAGCAAGCCGTACACTTTCCAGAAGGGCAAAGT
GTCGAAGAATCCGAACAAGAGTGTGTCCTTCAAGCAACGCACTCAGGCGTTCATTGAGCCCTTCACCCTGGATGTGTTCATCTCGAAACGGTTCGTGTCA
GCTTCACTCACTCACAGGGTGACTAGCAAGCAGGTTGCTACTGCCGGGACGAACTCGAAGGACATCAAGGCTGCGCTCAAGTCGAGGTCGGACATTCCGG
CCTGCCTAGCGATTGGCCGGATTCTGGCCGACCGGGCGAGGGAGGCTGATGTTTTCACTGCTGTCTACACTCCTAGGGAGAGGGATCGGTTTGAAGGCAA
GATTAGGGCTGTGGTTCAGTCTTTGATTGACAATGGGATTGATGTCAAAGTCTATCTTGAGTGA
AA sequence
>Lus10001727 pacid=23142982 polypeptide=Lus10001727 locus=Lus10001727.g ID=Lus10001727.BGIv1.0 annot-version=v1.0
MLKQALGKVLVREVLTSSISKLGPFSNAAINGFHTGQAHNAPRSFFGVEDFLDDDNSKPYTFQKGKVSKNPNKSVSFKQRTQAFIEPFTLDVFISKRFVS
ASLTHRVTSKQVATAGTNSKDIKAALKSRSDIPACLAIGRILADRAREADVFTAVYTPRERDRFEGKIRAVVQSLIDNGIDVKVYLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G08845 Ribosomal L18p/L5e family prot... Lus10001727 0 1
AT5G45920 SGNH hydrolase-type esterase s... Lus10000525 1.7 0.8902
AT3G02710 ARM repeat superfamily protein... Lus10026721 3.5 0.8810
AT5G55140 ribosomal protein L30 family p... Lus10031912 3.9 0.8729
AT3G60360 EDA14, UTP11 U3 SMALL NUCLEOLAR RNA-ASSOCIA... Lus10034210 15.0 0.8655
AT5G15220 Ribosomal protein L27 family p... Lus10007170 15.8 0.8680
AT5G27650 Tudor/PWWP/MBT superfamily pro... Lus10032634 16.1 0.8698
AT3G62140 unknown protein Lus10038035 19.3 0.8679
Lus10003137 19.4 0.8489
AT5G47890 NADH-ubiquinone oxidoreductase... Lus10030922 19.6 0.8504
AT3G10530 Transducin/WD40 repeat-like su... Lus10035742 20.0 0.8527

Lus10001727 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.