Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35732 50 / 6e-09 unknown protein AT2G04795 45 / 3e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002270 [exp] 180 / 2e-60 AT5G35732 57 / 1e-11 unknown protein Lus10006404 [exp] 97 / 3e-27 AT5G35732 82 / 1e-21 unknown protein Lus10012359 [exp] 67 / 7e-15 AT5G35732 / unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G222900 [exp] 68 / 3e-16 AT5G35732 102 / 2e-29 unknown protein Potri.014G162400 [exp] 61 / 2e-13 AT5G35732 96 / 5e-27 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001730 pacid=23170780 polypeptide=Lus10001730 locus=Lus10001730.g ID=Lus10001730.BGIv1.0 annot-version=v1.0 ATGTTTCGAACATTGGCAAGACTACGACGAGACACAAGGAAGAGCCCTAGGGTGGCCGACGAGACCACGTCGGGAGGGATGATCGTGACTAGAGTTGGTG GTGGTACTAGTGATCGGTGTCAACAACAACTACCCCCGATAACCCACAGTATCACGTTGAATAGGTTCATGACCACAGTCTTGAGCCAAGTCTTACTACC CTTCTCATGCTTGTCTCAGCCTCGTGTTAATATGGCCGATCGTATGTGGGCATCAACGGAGGTCAACAACCATGCGATGGTGAATGATAGCATGAGGTAT GCCATACCTATATGTAGTATGTAG
AA sequence Show only first row Show all	>Lus10001730 pacid=23170780 polypeptide=Lus10001730 locus=Lus10001730.g ID=Lus10001730.BGIv1.0 annot-version=v1.0 MFRTLARLRRDTRKSPRVADETTSGGMIVTRVGGGTSDRCQQQLPPITHSITLNRFMTTVLSQVLLPFSCLSQPRVNMADRMWASTEVNNHAMVNDSMRY AIPICSM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G35732			unknown protein		Lus10001730 [exp]	0	1
AT2G23970			Class I glutamine amidotransfe...		Lus10019964 [exp]	5.9	0.9279
AT5G46030			unknown protein		Lus10015293 [exp]	6.9	0.9052
AT3G44735		PSK1, ATPSK3	PHYTOSULFOKINE 3 PRECURSOR (.1...		Lus10027716 [exp]	7.1	0.9174
AT4G35000		APX3	ascorbate peroxidase 3 (.1)		Lus10000180 [exp]	8.8	0.9236
AT3G04030	GARP		Homeodomain-like superfamily p...		Lus10020264 [exp]	10.5	0.9226
AT3G04030	GARP		Homeodomain-like superfamily p...		Lus10002629 [exp]	11.1	0.9224
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10006084 [exp]	13.0	0.9169
AT2G01520		ZCE1, MLP328	\(Zusammen-CA\)-enhanced 1, ML...		Lus10028887 [exp]	13.1	0.8790
					Lus10019472 [exp]	16.1	0.9166
					Lus10033890 [exp]	17.0	0.9155

Compare expression of checked genes

Lus10001730 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.