Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35740 111 / 2e-33 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G04910 102 / 5e-30 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT1G11820 86 / 4e-21 O-Glycosyl hydrolases family 17 protein (.1.2) AT4G29360 86 / 5e-21 O-Glycosyl hydrolases family 17 protein (.1.2) AT5G56590 82 / 9e-20 O-Glycosyl hydrolases family 17 protein (.1) AT3G13560 81 / 2e-19 O-Glycosyl hydrolases family 17 protein (.1.2.3) AT4G13600 78 / 4e-19 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G79480 79 / 9e-19 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT2G01630 79 / 9e-19 O-Glycosyl hydrolases family 17 protein (.1.2) AT1G66250 79 / 1e-18 O-Glycosyl hydrolases family 17 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001167 [exp] 159 / 5e-52 AT5G35740 150 / 3e-48 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10012324 [exp] 125 / 9e-39 AT5G35740 164 / 8e-54 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10039059 [exp] 103 / 1e-29 AT5G35740 157 / 3e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10038801 [exp] 94 / 2e-26 AT5G35740 146 / 1e-46 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10031456 [exp] 91 / 5e-23 AT1G11820 796 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10034607 [exp] 84 / 2e-20 AT2G01630 691 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10015151 [exp] 81 / 2e-19 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10013465 [exp] 81 / 3e-19 AT2G01630 745 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10032601 [exp] 76 / 9e-19 AT4G13600 167 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G164600 [exp] 124 / 2e-38 AT5G35740 179 / 8e-60 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.006G016800 [exp] 114 / 3e-34 AT5G35740 156 / 1e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.007G111000 [exp] 83 / 1e-21 AT4G05430 148 / 5e-46 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G006100 [exp] 87 / 2e-21 AT1G11820 805 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.019G007800 [exp] 83 / 2e-21 AT4G05430 160 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.019G012000 [exp] 82 / 3e-21 AT4G05430 155 / 3e-49 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.004G010500 [exp] 86 / 5e-21 AT1G11820 794 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.008G082900 [exp] 84 / 1e-20 AT1G79480 159 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.001G006500 [exp] 84 / 3e-20 AT3G13560 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Potri.010G173500 [exp] 82 / 5e-20 AT1G79480 162 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [flax] [poplar] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Lus10001740 pacid=23170797 polypeptide=Lus10001740 locus=Lus10001740.g ID=Lus10001740.BGIv1.0 annot-version=v1.0 ATGGTGCATAGCAGACGTACAAACACCGGATGGCTGCAGTCTGCGATGACTTGGGCTTGCGAGAAGGGAAGGGCAGATTGCAGTAAGGTTCAGGCGAATC AGCATTGTTTCTGGCCTAACACCACGATAGACCACGCCTCGTATGTCTTCAATAACTACTTCCAGCAGTTCAAGCACACAGGCGGGTCTTGTTACTTCAA TGGAGCCGGCATTGTTACATACCTTGATCCTAGCCATGGCTCTTGTCAGTTCGAGTTCATTGCCTAA
AA sequence Show only first row Show all	>Lus10001740 pacid=23170797 polypeptide=Lus10001740 locus=Lus10001740.g ID=Lus10001740.BGIv1.0 annot-version=v1.0 MVHSRRTNTGWLQSAMTWACEKGRADCSKVQANQHCFWPNTTIDHASYVFNNYFQQFKHTGGSCYFNGAGIVTYLDPSHGSCQFEFIA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G35740			Carbohydrate-binding X8 domain...		Lus10001740 [exp]	0	1
AT1G30820			CTP synthase family protein (....		Lus10001218 [exp]	3.6	0.8119
AT1G69040		ACR4	ACT domain repeat 4 (.1.2)		Lus10019192 [exp]	7.1	0.7164
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10008939 [exp]	7.3	0.6996
AT2G27310			F-box family protein (.1)		Lus10003731 [exp]	8.0	0.7694
AT3G24330			O-Glycosyl hydrolases family 1...		Lus10017740 [exp]	21.5	0.6978
AT5G08350			GRAM domain-containing protein...		Lus10013445 [exp]	24.0	0.6851
AT4G31020			alpha/beta-Hydrolases superfam...		Lus10040038 [exp]	26.1	0.7074
AT3G24330			O-Glycosyl hydrolases family 1...		Lus10033082 [exp]	30.8	0.6780
AT1G69040		ACR4	ACT domain repeat 4 (.1.2)		Lus10036827 [exp]	31.1	0.6577
AT4G31020			alpha/beta-Hydrolases superfam...		Lus10019604 [exp]	31.9	0.6536

Compare expression of checked genes

Lus10001740 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.