Lus10001743 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07760 152 / 7e-49 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001171 153 / 6e-46 AT2G05250 308 / 2e-98 DNAJ heat shock N-terminal domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G165300 166 / 1e-54 AT3G07760 229 / 3e-79 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0003 SAM PF07647 SAM_2 SAM domain (Sterile alpha motif)
Representative CDS sequence
>Lus10001743 pacid=23170786 polypeptide=Lus10001743 locus=Lus10001743.g ID=Lus10001743.BGIv1.0 annot-version=v1.0
ATGGTGGGTTATTTCGTTAAGAGATTTAGCAAGGAGATGATCAACAAAGAGAAGCCTCCCGAGCCGCTCGATTTCTTCATTTGGACTGTTGAGGATGTTG
GTTTGTGGTTGGAAGAAATAAACCTGGGTAGCTACCGTCAGATTTTCAAAGAAAATGGTGTTAATGGAGAATATCTTGAGGGCATGTCCATGTTCACAAC
CGAACAGATACTAAGGTTTATAAGGCGGTGCCACATGAAATGGGGCGACTTCATTACGCTGTGCAAGGAGCTCAGAAGAATCAAAGGTTTGTCCCCTCTT
CACTCTACATCTCCCCTCACTCTTCTCTTTGTCTATGGATCGCGCATTTAG
AA sequence
>Lus10001743 pacid=23170786 polypeptide=Lus10001743 locus=Lus10001743.g ID=Lus10001743.BGIv1.0 annot-version=v1.0
MVGYFVKRFSKEMINKEKPPEPLDFFIWTVEDVGLWLEEINLGSYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKGLSPL
HSTSPLTLLFVYGSRI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07760 Sterile alpha motif (SAM) doma... Lus10001743 0 1
AT1G77000 ATSKP2;2, SKP2B ARABIDOPSIS HOMOLOG OF HOMOLOG... Lus10000776 12.6 0.8218
AT5G16120 alpha/beta-Hydrolases superfam... Lus10017601 16.9 0.8296
AT4G28240 Wound-responsive family protei... Lus10018535 17.5 0.7944
AT5G45380 ATDUR3 DEGRADATION OF UREA 3, solute:... Lus10037255 17.5 0.7851
AT3G28050 nodulin MtN21 /EamA-like trans... Lus10039428 17.7 0.8273
AT3G46170 NAD(P)-binding Rossmann-fold s... Lus10006699 19.1 0.8135
AT5G12200 PYD2 pyrimidine 2 (.1) Lus10026817 23.7 0.8275
AT1G33780 Protein of unknown function (D... Lus10001286 24.9 0.8219
AT1G29800 RING/FYVE/PHD-type zinc finger... Lus10029271 28.6 0.8144
AT2G31450 ATNTH1 DNA glycosylase superfamily pr... Lus10025575 35.7 0.8054

Lus10001743 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.