Lus10001746 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10001746 pacid=23170802 polypeptide=Lus10001746 locus=Lus10001746.g ID=Lus10001746.BGIv1.0 annot-version=v1.0
ATGCAACTCAAAAAGTATATACAAAAGCAGCTAACTACAACGGTCAAAAGGCAACACACATCCAAGAGTAAAAACAGGACAAGTGCTATATTTTCAACTC
TCCACAACAAACGGATAAATTTGCAATCGTCCGTCACCAGCCAGCAAGTGCACCACTGTGTACTCGACCTTAGTCGTCGTATCTGTCTCTCCCTCGCCGA
TCTCCTGGCTCAAAGTCGTCGCCCTGAATCGGAGAAAGTCGTCGACTCGTCGTTCCCGTCTTCCCGAATCGAAGGCTGCTGTCCGTCCCTCTCCCCTGCA
TCTCCTCCGGCTCCAAGTCGTCCACTCGCCGTTCGCGAATCGAAGGCTGTTGTCCGCCCCTCTCCCCTGCTTGGTCGTAGAAGTGTTGGCCCTTGGGTGA
TTGGATTTGGAAGGTAA
AA sequence
>Lus10001746 pacid=23170802 polypeptide=Lus10001746 locus=Lus10001746.g ID=Lus10001746.BGIv1.0 annot-version=v1.0
MQLKKYIQKQLTTTVKRQHTSKSKNRTSAIFSTLHNKRINLQSSVTSQQVHHCVLDLSRRICLSLADLLAQSRRPESEKVVDSSFPSSRIEGCCPSLSPA
SPPAPSRPLAVRESKAVVRPSPLLGRRSVGPWVIGFGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001746 0 1
AT4G21970 Protein of unknown function, D... Lus10040067 7.3 0.7490
Lus10017380 8.2 0.7062
AT5G24860 ATFPF1, FPF1 ARABIDOPSIS FLOWERING PROMOTIN... Lus10000506 18.4 0.7448
AT5G25090 AtENODL13 early nodulin-like protein 13 ... Lus10003432 22.7 0.7011
Lus10035412 27.2 0.7309
Lus10012543 28.1 0.6691
AT1G25270 nodulin MtN21 /EamA-like trans... Lus10020819 33.8 0.6688
AT4G39010 ATGH9B18 glycosyl hydrolase 9B18 (.1) Lus10018077 37.1 0.6445
AT5G59700 Protein kinase superfamily pro... Lus10020474 37.4 0.6728
AT2G46760 D-arabinono-1,4-lactone oxidas... Lus10030206 40.7 0.5764

Lus10001746 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.