Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001749 pacid=23170787 polypeptide=Lus10001749 locus=Lus10001749.g ID=Lus10001749.BGIv1.0 annot-version=v1.0 ATGAAGAGGGAATGTGGAGATGTGAGGAAAGTTGGTGTTTATGGCTTTTGGATGAAGCTTGGGAAGTGTGAGTCTGTGAAACGGGAAGCAAAAGCAAAGC ACTGTGAAGGACCTGATTATATAAACTTAGGGATTCTCCTAGGAAACCCCAAAACAGCTGGTTCCTCTGCATTGGGTGACAGTAACAAGTAG
AA sequence Show only first row Show all	>Lus10001749 pacid=23170787 polypeptide=Lus10001749 locus=Lus10001749.g ID=Lus10001749.BGIv1.0 annot-version=v1.0 MKRECGDVRKVGVYGFWMKLGKCESVKREAKAKHCEGPDYINLGILLGNPKTAGSSALGDSNK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10001749 [exp]	0	1
AT1G67960		POD1	POLLEN DEFECTIVE IN GUIDANCE 1...		Lus10015372 [exp]	13.2	0.6925
AT5G29000	GARP	PHL1	PHR1-like 1, Homeodomain-like ...		Lus10032778 [exp]	35.5	0.6858
AT1G01650		ATSPPL4	ARABIDOPSIS THALIANA SIGNAL PE...		Lus10017796 [exp]	37.7	0.6868
AT1G75340	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Lus10040567 [exp]	49.6	0.6462
AT2G18750			Calmodulin-binding protein (.1...		Lus10029852 [exp]	58.5	0.6649
					Lus10019222 [exp]	60.8	0.6109
AT3G07940			Calcium-dependent ARF-type GTP...		Lus10002760 [exp]	63.8	0.6540
AT4G35550	HD	HB-4, WOX13, AT...	WUSCHEL related homeobox 13 (....		Lus10016026 [exp]	74.5	0.6254
					Lus10039517 [exp]	84.7	0.6246
AT5G52280			Myosin heavy chain-related pro...		Lus10016240 [exp]	96.6	0.5757

Compare expression of checked genes

Lus10001749 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.