Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G04480 54 / 2e-09 unknown protein AT5G35870 53 / 2e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001176 [exp] 207 / 8e-71 AT5G35870 53 / 2e-09 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G167700 [exp] 69 / 6e-15 AT5G55650 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001750 pacid=23170795 polypeptide=Lus10001750 locus=Lus10001750.g ID=Lus10001750.BGIv1.0 annot-version=v1.0 ATGGAAGAGCAAGAGGAAGAGGAATACGAGGTGAGAAGAGAGCTAACCGATGGCGAGTGCGAGGGAAGGCTATCGTCGACGACGAGCGAGGAATCAGAGG TGGACTACTGGCCGTTTCAAGGGAACATGTTCCAGAGCCCCGATTGCTTCGACGCCGGATACATATCTGACGAGGAAAGCCTGATTGAGATTGCACTTCC AGGCGGGGAATTCGTTCGTCACCCAACTCCGTTCAGCTGCAAAGATGGTCAGTTCGGGATTCGGAGCTCGTTTTACAAGCAGATGATGATTGAGGAAGAT AACCTGATCGAGATTGACATTTCAATTGGATCGATTAAATCAACTCCTAGGTTCGAGATTGAAGCTTCTTAA
AA sequence Show only first row Show all	>Lus10001750 pacid=23170795 polypeptide=Lus10001750 locus=Lus10001750.g ID=Lus10001750.BGIv1.0 annot-version=v1.0 MEEQEEEEYEVRRELTDGECEGRLSSTTSEESEVDYWPFQGNMFQSPDCFDAGYISDEESLIEIALPGGEFVRHPTPFSCKDGQFGIRSSFYKQMMIEED NLIEIDISIGSIKSTPRFEIEAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G04480			unknown protein		Lus10001750 [exp]	0	1
AT4G04980			unknown protein		Lus10036173 [exp]	1.0	0.9085
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Lus10017777 [exp]	3.0	0.8255
AT5G19410		ABCG23	ATP-binding cassette G23, ABC-...		Lus10033637 [exp]	3.5	0.8634
AT5G42700	B3		AP2/B3-like transcriptional fa...		Lus10024689 [exp]	5.0	0.8006
AT3G07570			Cytochrome b561/ferric reducta...		Lus10012305 [exp]	6.3	0.8188
					Lus10025813 [exp]	8.7	0.7645
AT4G11610		NTRB, ATNTRB	C2 calcium/lipid-binding plant...		Lus10000605 [exp]	10.1	0.7686
AT4G05160			AMP-dependent synthetase and l...		Lus10013831 [exp]	11.2	0.7813
AT4G27090			Ribosomal protein L14 (.1)		Lus10003627 [exp]	14.3	0.7523
AT1G30800			Fasciclin-like arabinogalactan...		Lus10023390 [exp]	16.0	0.6441

Compare expression of checked genes

Lus10001750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.