Lus10001767 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15750 291 / 4e-102 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
AT5G15200 49 / 2e-07 Ribosomal protein S4 (.1.2)
AT5G39850 47 / 2e-06 Ribosomal protein S4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012839 50 / 1e-07 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2)
Lus10030487 50 / 1e-07 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2)
Lus10008624 49 / 3e-07 AT5G15200 342 / 8e-122 Ribosomal protein S4 (.1.2)
Lus10042193 46 / 8e-06 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G101200 313 / 7e-111 AT5G15750 291 / 6e-102 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
Potri.004G113600 312 / 3e-110 AT5G15750 312 / 3e-110 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
Potri.011G094500 51 / 5e-08 AT5G39850 336 / 3e-119 Ribosomal protein S4 (.1)
Potri.016G076500 47 / 9e-07 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1)
Potri.016G076800 47 / 9e-07 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1)
Potri.007G056100 47 / 1e-06 AT5G39850 337 / 1e-119 Ribosomal protein S4 (.1)
Potri.006G209700 47 / 1e-06 AT5G39850 325 / 6e-115 Ribosomal protein S4 (.1)
Potri.018G062300 47 / 2e-06 AT5G39850 332 / 1e-117 Ribosomal protein S4 (.1)
Potri.006G209801 42 / 2e-05 AT5G15200 200 / 7e-67 Ribosomal protein S4 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0492 S4 PF01479 S4 S4 domain
CL0492 S4 PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
Representative CDS sequence
>Lus10001767 pacid=23159137 polypeptide=Lus10001767 locus=Lus10001767.g ID=Lus10001767.BGIv1.0 annot-version=v1.0
ATGAGGAAGTTGAAGTATCATGAGAAGAAGCTTCTAAAGAAGGTCAATCTCTTTGATTGGAAGAGGGAAGGTAACCATAGGGAATCCCAGGTGATGCAAC
GCTACCATGTTGTCGATCGTGATGACTACAAGAAATACTCGGGTTTGTGCCGGATGGTGCAGAAATTGGTCAACATCTTGAAACAGATGCACCCCAAAGA
CCCCTATCGCATTGAGATGACTGATATGCTTCTGGAGAAATTATATAACATGGGCGTTATACCAAGCAGGAAGAGCTTAGCCCTATGCGACCGCCTGTCA
GTTTCTTCCTTCTGCAGACGAAGGCTTGCAACTGTGTTAGTACGTTTGAAGTTTACTGAACATCTGAAAGAAGCAGTGACGTTCATCGAACAGGGCCATA
TTCGAGTAGGTCCAGAGACAGTGACTGACCCTGCATTCCTGGTTACTAGGAACATGGAAGACTTCATCACCTGGGTGGATACATCCAAGATTAGGAGGAA
GGTGCTACAGTACAACGATAAACTCGACGACTATGATGCCATGAACTGA
AA sequence
>Lus10001767 pacid=23159137 polypeptide=Lus10001767 locus=Lus10001767.g ID=Lus10001767.BGIv1.0 annot-version=v1.0
MRKLKYHEKKLLKKVNLFDWKREGNHRESQVMQRYHVVDRDDYKKYSGLCRMVQKLVNILKQMHPKDPYRIEMTDMLLEKLYNMGVIPSRKSLALCDRLS
VSSFCRRRLATVLVRLKFTEHLKEAVTFIEQGHIRVGPETVTDPAFLVTRNMEDFITWVDTSKIRRKVLQYNDKLDDYDAMN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G15750 Alpha-L RNA-binding motif/Ribo... Lus10001767 0 1
AT4G39200 Ribosomal protein S25 family p... Lus10021706 4.1 0.9366
AT1G48830 Ribosomal protein S7e family p... Lus10028789 10.0 0.9341
AT3G16080 Zinc-binding ribosomal protein... Lus10037549 11.5 0.9341
AT1G61010 CPSF73-I cleavage and polyadenylation s... Lus10001372 11.7 0.8778
AT2G47640 Small nuclear ribonucleoprotei... Lus10026556 12.8 0.9130
AT1G03860 ATPHB2 prohibitin 2 (.1.2.3) Lus10021978 14.1 0.9317
AT3G01790 Ribosomal protein L13 family p... Lus10032063 15.6 0.9233
AT2G30260 U2B'' U2 small nuclear ribonucleopro... Lus10042240 17.7 0.9088
AT1G13690 ATE1 ATPase E1 (.1) Lus10004641 18.2 0.9212
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10022881 18.4 0.9157

Lus10001767 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.