Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G26210 224 / 2e-77 Mitochondrial ATP synthase subunit G protein (.1.2) AT4G29480 221 / 5e-76 Mitochondrial ATP synthase subunit G protein (.1) AT2G19680 217 / 1e-74 Mitochondrial ATP synthase subunit G protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040553 [exp] 250 / 1e-87 AT4G26210 228 / 9e-79 Mitochondrial ATP synthase subunit G protein (.1.2) Lus10040544 [exp] 250 / 1e-87 AT4G26210 228 / 9e-79 Mitochondrial ATP synthase subunit G protein (.1.2) Lus10007995 [exp] 248 / 5e-86 AT4G26210 225 / 6e-77 Mitochondrial ATP synthase subunit G protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G055700 [exp] 222 / 1e-76 AT4G26210 210 / 9e-72 Mitochondrial ATP synthase subunit G protein (.1.2) Potri.006G232000 [exp] 213 / 6e-73 AT4G29480 212 / 2e-72 Mitochondrial ATP synthase subunit G protein (.1) Potri.006G231900 [exp] 207 / 1e-70 AT4G29480 181 / 3e-60 Mitochondrial ATP synthase subunit G protein (.1) Potri.018G055501 [exp] 131 / 8e-41 AT2G19680 130 / 2e-40 Mitochondrial ATP synthase subunit G protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04718 [flax] [poplar] ATP-synt_G Mitochondrial ATP synthase g subunit
Representative CDS sequence Show only first row Show all	>Lus10001771 pacid=23142790 polypeptide=Lus10001771 locus=Lus10001771.g ID=Lus10001771.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAATTAATGCAATTGCAATCTAAAGCGTGCCAAGCGTCTAAGTTTGTGTCTAAGCATGGCACTACCTACTACAAACAGTTACTGGAACAGA ACAAGAAATACATTCAGGAGCCTGCTAGTGTTGAGAAGTGCAATGAATTGTCTAAACAATTGTTTTACACTCGGCTAGCCAGTATCCCGGGTAGAAATGA AGCATTATGGAAGGAGCTTGACTACGTGAAGAACTTATGGAAGAACAGGCATGAGCTGAAGGTTGAGGATGCAGGAGTTGCTGCATTGTTTGGAGTTGAG TGCTTCGCATGGTATTGTGCTGGTGAAATCATCGGGAGGGGATTCACCTTCACTGGCTACTACCCTTGA
AA sequence Show only first row Show all	>Lus10001771 pacid=23142790 polypeptide=Lus10001771 locus=Lus10001771.g ID=Lus10001771.BGIv1.0 annot-version=v1.0 MASKLMQLQSKACQASKFVSKHGTTYYKQLLEQNKKYIQEPASVEKCNELSKQLFYTRLASIPGRNEALWKELDYVKNLWKNRHELKVEDAGVAALFGVE CFAWYCAGEIIGRGFTFTGYYP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G26210			Mitochondrial ATP synthase sub...		Lus10001771 [exp]	0	1
AT4G26210			Mitochondrial ATP synthase sub...		Lus10007995 [exp]	1.7	0.9457
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Lus10022057 [exp]	3.6	0.9517
AT1G22780		RPS18A, PFL1, P...	40S RIBOSOMAL PROTEIN S18, POI...		Lus10042603 [exp]	4.9	0.9505
AT5G35620		eIFiso4E, EIF(I...	LOSS OF SUSCEPTIBILITY TO POTY...		Lus10023733 [exp]	5.2	0.9342
AT3G56210			ARM repeat superfamily protein...		Lus10017416 [exp]	5.5	0.9386
AT4G21105			cytochrome-c oxidases;electron...		Lus10006275 [exp]	6.9	0.9389
AT1G07770		RPS15A	ribosomal protein S15A (.1.2)		Lus10043001 [exp]	6.9	0.9359
AT5G23535			KOW domain-containing protein ...		Lus10022069 [exp]	8.4	0.9331
AT1G26880			Ribosomal protein L34e superfa...		Lus10037177 [exp]	10.4	0.9374
AT4G14320			Zinc-binding ribosomal protein...		Lus10000176 [exp]	10.6	0.9366

Compare expression of checked genes

Lus10001771 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.