Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43610 44 / 3e-06 Chitinase family protein (.1) AT2G43620 40 / 0.0001 Chitinase family protein (.1) AT3G54420 38 / 0.0004 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001773 [exp] 91 / 4e-24 AT2G43570 51 / 6e-08 "chitinase, putative", chitinase, putative (.1) Lus10020253 [exp] 86 / 2e-22 AT2G43610 54 / 4e-09 Chitinase family protein (.1) Lus10028377 [exp] 55 / 7e-10 AT3G12500 393 / 1e-137 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10041830 [exp] 54 / 2e-09 AT3G12500 402 / 4e-141 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10041828 [exp] 50 / 3e-09 AT3G12500 59 / 8e-12 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10025948 [exp] 49 / 8e-08 AT2G43610 50 / 3e-07 Chitinase family protein (.1) Lus10006552 [exp] 43 / 1e-05 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003585 [exp] 40 / 2e-05 AT3G12500 47 / 1e-07 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10014253 [exp] 41 / 3e-05 AT2G43570 46 / 1e-06 "chitinase, putative", chitinase, putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G142000 [exp] 46 / 7e-07 AT3G12500 346 / 6e-119 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.004G182000 [exp] 44 / 6e-06 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142300 [exp] 44 / 6e-06 AT3G12500 340 / 1e-116 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G141700 [exp] 42 / 2e-05 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G141800 [exp] 41 / 5e-05 AT3G12500 351 / 9e-121 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.013G041700 [exp] 39 / 0.0002 AT3G04720 248 / 4e-84 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041900 [exp] 39 / 0.0002 AT3G04720 251 / 1e-85 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.019G094100 [exp] 37 / 0.0008 AT3G54420 350 / 3e-122 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.013G041600 [exp] 37 / 0.001 AT3G04720 266 / 3e-91 HEVEIN-LIKE, pathogenesis-related 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00187 [flax] [poplar] Chitin_bind_1 Chitin recognition protein
Representative CDS sequence Show only first row Show all	>Lus10001772 pacid=23174793 polypeptide=Lus10001772 locus=Lus10001772.g ID=Lus10001772.BGIv1.0 annot-version=v1.0 ATGGGAAAATCAGCAACCAATCCCCATATCCCGTCCCGAATTCTAATATTAATCACGACCGCAGCACTATTTGCTGTCGCTAATGCTCAGAACTGCGGCC CCGAAGGCGGTAAGGTCCATTGTGATGGCAAAAACTGCTGCAGCGGTGATAACTGGTGCGGAATCACGGATAAACACTGCGGCAAGGGATGCCAGCCCAA ATACGGCATGTGCACGTTACCCGGCGGCCGCAGCAGCTCCCCCGGGCCAGCTGGCCCGTCCTTCTTCGACTTGGACGATGAACACCATTCGCCGCCGTAC CCTGATCACGACCTGGAGACTCTGTCGTCACCGGCTAATTAG
AA sequence Show only first row Show all	>Lus10001772 pacid=23174793 polypeptide=Lus10001772 locus=Lus10001772.g ID=Lus10001772.BGIv1.0 annot-version=v1.0 MGKSATNPHIPSRILILITTAALFAVANAQNCGPEGGKVHCDGKNCCSGDNWCGITDKHCGKGCQPKYGMCTLPGGRSSSPGPAGPSFFDLDDEHHSPPY PDHDLETLSSPAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G43610			Chitinase family protein (.1)		Lus10001772 [exp]	0	1
AT1G04645			Plant self-incompatibility pro...		Lus10002219 [exp]	4.2	0.9939
					Lus10009439 [exp]	5.1	0.9773
					Lus10005830 [exp]	6.0	0.9939
AT5G38195			Bifunctional inhibitor/lipid-t...		Lus10017615 [exp]	7.1	0.9423
					Lus10009618 [exp]	7.3	0.9939
AT4G03220			Protein with RNI-like/FBD-like...		Lus10023567 [exp]	8.5	0.9939
AT5G18410		ATSRA1, KLK, PI...	PIROGI 121, PIROGI, KLUNKER, t...		Lus10003109 [exp]	8.6	0.9149
AT1G75790		SKS18	SKU5 similar 18 (.1)		Lus10013556 [exp]	9.5	0.9939
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10039085 [exp]	10.4	0.9939
AT3G03080			Zinc-binding dehydrogenase fam...		Lus10003638 [exp]	10.5	0.9933

Compare expression of checked genes

Lus10001772 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.