Lus10001773 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43570 49 / 4e-07 CHI "chitinase, putative", chitinase, putative (.1)
AT2G43610 47 / 2e-06 Chitinase family protein (.1)
AT2G43620 45 / 5e-06 Chitinase family protein (.1)
AT3G54420 44 / 1e-05 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
AT2G43580 44 / 1e-05 Chitinase family protein (.1)
AT2G43590 44 / 2e-05 Chitinase family protein (.1)
AT2G43600 42 / 8e-05 Chitinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020253 213 / 2e-71 AT2G43610 54 / 4e-09 Chitinase family protein (.1)
Lus10001772 89 / 6e-23 AT2G43610 44 / 5e-06 Chitinase family protein (.1)
Lus10020338 80 / 2e-19 AT2G43620 57 / 2e-10 Chitinase family protein (.1)
Lus10028377 52 / 3e-08 AT3G12500 393 / 1e-137 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Lus10041830 50 / 1e-07 AT3G12500 402 / 4e-141 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Lus10041828 47 / 2e-07 AT3G12500 59 / 8e-12 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Lus10014253 44 / 5e-06 AT2G43570 46 / 1e-06 "chitinase, putative", chitinase, putative (.1)
Lus10025948 45 / 7e-06 AT2G43610 50 / 3e-07 Chitinase family protein (.1)
Lus10006552 45 / 8e-06 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G093800 47 / 1e-06 AT3G54420 369 / 8e-130 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G094100 45 / 5e-06 AT3G54420 350 / 3e-122 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G093900 43 / 5e-05 AT3G54420 360 / 3e-126 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G093700 42 / 5e-05 AT3G54420 413 / 3e-147 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.004G182000 41 / 0.0001 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.013G125100 41 / 0.0002 AT3G54420 336 / 1e-116 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.009G141700 41 / 0.0002 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.013G041700 40 / 0.0002 AT3G04720 248 / 4e-84 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Potri.013G041900 40 / 0.0002 AT3G04720 251 / 1e-85 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Potri.019G094000 40 / 0.0003 AT3G54420 340 / 2e-118 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00187 Chitin_bind_1 Chitin recognition protein
Representative CDS sequence
>Lus10001773 pacid=23174805 polypeptide=Lus10001773 locus=Lus10001773.g ID=Lus10001773.BGIv1.0 annot-version=v1.0
ATGGCAAAATCAGCAACCAATGCTTCTTTCTCGTCCCTAATAGCAATCTTAATTGTGACAGCAATGCTTTTCGCTGTCGCTAATTCTCAAAATTGCGGCG
AAGATGGCAACAACGCCCGTTGCTCGGACGACAACTGTTGCAGCCAGAGTAGCTGGTGCGGGGTCTCCGACGCACACTGCGGCCACGGATGTCAGCCCGG
CTTCGGCAAGTGTTCGTCGTCCGGTGGTGGCGGCGGCGGCGGCGTCCCCGGGCCAGATCCCGGCGTGTCCTTCTTCGAGTTGGACGGTAAGCACTATTCG
CCTACGCCGATAACGAAGAACCTCACGCACGACGACAGTTATTACAGCACTCCGAACTGCGGGAGTCAGGCCGACGATAAAGAGTGCGAAGAGACAAAAT
ACTGCTGCAGTCAGTTTGGTTTCTGTGGGGAAACAGATAAGTATTGTGGCAAGAAATGCCAGTCCGGCCCGTGTACGGGCGGTAGCGGCGGACAAGAGCC
GAAGACTCCATCGCCGTCTAATTAG
AA sequence
>Lus10001773 pacid=23174805 polypeptide=Lus10001773 locus=Lus10001773.g ID=Lus10001773.BGIv1.0 annot-version=v1.0
MAKSATNASFSSLIAILIVTAMLFAVANSQNCGEDGNNARCSDDNCCSQSSWCGVSDAHCGHGCQPGFGKCSSSGGGGGGGVPGPDPGVSFFELDGKHYS
PTPITKNLTHDDSYYSTPNCGSQADDKECEETKYCCSQFGFCGETDKYCGKKCQSGPCTGGSGGQEPKTPSPSN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G43570 CHI "chitinase, putative", chitina... Lus10001773 0 1
AT5G59590 UGT76E2 UDP-glucosyl transferase 76E2 ... Lus10016459 1.0 0.9720
Lus10031461 16.5 0.8381
AT2G24180 CYP71B6 cytochrome p450 71b6 (.1) Lus10017697 21.3 0.9297
AT4G35150 O-methyltransferase family pro... Lus10017699 26.6 0.9223
AT5G54740 SESA5 seed storage albumin 5 (.1) Lus10023513 29.7 0.9223
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10024627 34.9 0.9218
AT3G21720 ICL isocitrate lyase (.1) Lus10031552 38.4 0.9213
Lus10014857 41.4 0.9212
Lus10026755 44.3 0.9212
Lus10022172 47.0 0.9212

Lus10001773 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.