Lus10001790 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013260 104 / 2e-29 ND 37 / 0.003
Lus10013258 95 / 1e-25 ND /
Lus10013259 92 / 3e-24 ND /
Lus10030782 90 / 9e-24 ND 39 / 4e-04
Lus10030783 81 / 2e-20 ND 35 / 0.009
Lus10034545 76 / 3e-18 ND /
Lus10013255 71 / 2e-16 ND /
Lus10030775 70 / 1e-15 ND /
Lus10032027 69 / 1e-15 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10001790 pacid=23169679 polypeptide=Lus10001790 locus=Lus10001790.g ID=Lus10001790.BGIv1.0 annot-version=v1.0
ATGCAACTTTTCGATCACCCAAATTACAGACTCATGATTGCAATAACCACCGTAGTTATGTTACTTGTTGTCGCGGTTGCCATACAATCTTGCAGCAAAA
AGGCACCGTCAGGTCACGGCCCTTGTAAAGGGCACTACGCTGTATGCGTAAAGACACCACTCAGGAAGTTATTGGAGAACACGGCGTACGCCGCCGATGA
CACGTTCACCGCATCTCAACCGGACGGACAACCAAGTGGCAGATTTAGGGGTCACGCGACTTGCGTTGTTACATATGGCCAGGCCGATTGCCGGAGCTGC
CTTAGTGGCGCCAAAGAGTGGTTGTCCACCTATTGTGCTAGTAAGGATCATAGCAAAGGCCATTACTCTTTTGGTATTTGCGCCATGTCTTTCCAACAAA
TTGACCAATTGTACGTCCGCCTCGGAGTCTAA
AA sequence
>Lus10001790 pacid=23169679 polypeptide=Lus10001790 locus=Lus10001790.g ID=Lus10001790.BGIv1.0 annot-version=v1.0
MQLFDHPNYRLMIAITTVVMLLVVAVAIQSCSKKAPSGHGPCKGHYAVCVKTPLRKLLENTAYAADDTFTASQPDGQPSGRFRGHATCVVTYGQADCRSC
LSGAKEWLSTYCASKDHSKGHYSFGICAMSFQQIDQLYVRLGV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001790 0 1
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000683 2.0 1.0000
AT4G17810 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers sup... Lus10000481 2.4 1.0000
Lus10006164 3.5 1.0000
AT5G13660 unknown protein Lus10005963 4.2 1.0000
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10030409 5.5 1.0000
AT5G20260 Exostosin family protein (.1) Lus10039981 6.0 1.0000
AT2G01690 ARM repeat superfamily protein... Lus10003679 6.0 0.9937
AT1G73700 MATE efflux family protein (.1... Lus10042705 6.5 1.0000
AT4G38260 Protein of unknown function (D... Lus10016023 6.9 0.9994
AT4G02320 Plant invertase/pectin methyle... Lus10001467 7.7 0.9887

Lus10001790 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.