Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63060 87 / 2e-23 unknown protein AT5G07330 62 / 1e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002567 [exp] 190 / 5e-65 AT1G63060 89 / 3e-24 unknown protein Lus10000001 [exp] 141 / 8e-46 AT1G63060 71 / 1e-17 unknown protein Lus10018040 [exp] 74 / 9e-18 AT5G07330 117 / 1e-33 unknown protein Lus10042036 [exp] 71 / 8e-17 AT5G07330 118 / 3e-34 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G160700 [exp] 103 / 1e-29 AT1G63060 114 / 4e-33 unknown protein Potri.015G109100 [exp] 72 / 3e-17 AT5G07330 133 / 3e-40 unknown protein Potri.012G111000 [exp] 70 / 2e-16 AT5G07330 130 / 4e-39 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001796 pacid=23140350 polypeptide=Lus10001796 locus=Lus10001796.g ID=Lus10001796.BGIv1.0 annot-version=v1.0 ATGCATATATGTGTATTTTGTAGGTATGCATTGACGGGGGAATATGCACCGGTATATATAGTGATGGGCTTTGTGACGTTGGCGGCAGGTATAGGGATCC ACTCAGTAAAACAACAGCTATTACACTCCCCAGGAGTGAGTCTGAAGAAGACGAGGAGAGGATCGATGTCAGAGGCTGATAACCCGGATCTTGCAACTGC TAACGCACAAGACTTTCTCAACAAATCTTTCCTCCGTAAAATTGCTCGCATCCAACAGCAACAAGACAAGAATTAA
AA sequence Show only first row Show all	>Lus10001796 pacid=23140350 polypeptide=Lus10001796 locus=Lus10001796.g ID=Lus10001796.BGIv1.0 annot-version=v1.0 MHICVFCRYALTGEYAPVYIVMGFVTLAAGIGIHSVKQQLLHSPGVSLKKTRRGSMSEADNPDLATANAQDFLNKSFLRKIARIQQQQDKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G63060			unknown protein		Lus10001796 [exp]	0	1
AT1G63060			unknown protein		Lus10002567 [exp]	1.0	1.0000
					Lus10041320 [exp]	1.4	0.9419
AT3G22060			Receptor-like protein kinase-r...		Lus10022286 [exp]	1.7	0.9125
AT4G29035			Plant self-incompatibility pro...		Lus10019767 [exp]	2.2	0.8659
					Lus10030519 [exp]	2.8	0.8087
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10001886 [exp]	2.8	0.8832
AT1G25270			nodulin MtN21 /EamA-like trans...		Lus10012691 [exp]	4.2	0.8244
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10019779 [exp]	4.9	0.6576
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Lus10018523 [exp]	7.2	0.7846
AT1G65810			P-loop containing nucleoside t...		Lus10035774 [exp]	9.4	0.7973

Compare expression of checked genes

Lus10001796 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.