Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G21090 218 / 3e-72 Leucine-rich repeat (LRR) family protein (.1) AT3G43740 214 / 1e-70 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) AT1G71830 186 / 2e-55 ATSERK1, SERK1 somatic embryogenesis receptor-like kinase 1 (.1) AT1G34210 185 / 4e-55 ATSERK2, SERK2 somatic embryogenesis receptor-like kinase 2 (.1) AT4G33430 174 / 5e-51 SERK3, RKS10, ELG, BAK1, ATSERK3, ATBAK1 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) AT2G13790 163 / 3e-47 BAK7, BKK1, ATSERK4 BAK1-LIKE 1, BRI1- ASSOCIATED KINASE 7, somatic embryogenesis receptor-like kinase 4 (.1) AT2G13800 152 / 6e-43 BAK8, ATSERK5 BRI1- ASSOCIATED KINASE 8, SOMATIC EMBRYOGENESIS RECEPTOR LIKE KINASE 5, somatic embryogenesis receptor-like kinase 5 (.1) AT3G25560 103 / 2e-25 NIK2 NSP-interacting kinase 2 (.1.2.3) AT1G60800 96 / 5e-23 NIK3 NSP-interacting kinase 3 (.1) AT5G10290 94 / 3e-22 leucine-rich repeat transmembrane protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002579 [exp] 314 / 4e-110 AT5G21090 275 / 3e-94 Leucine-rich repeat (LRR) family protein (.1) Lus10002117 [exp] 189 / 1e-60 AT3G43740 273 / 9e-94 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Lus10026751 [exp] 181 / 5e-58 AT5G21090 250 / 2e-85 Leucine-rich repeat (LRR) family protein (.1) Lus10013902 [exp] 193 / 1e-56 AT1G49870 454 / 2e-145 unknown protein Lus10020962 [exp] 183 / 2e-54 AT4G33430 989 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) Lus10042755 [exp] 168 / 1e-52 AT5G21090 199 / 8e-65 Leucine-rich repeat (LRR) family protein (.1) Lus10004958 [exp] 155 / 2e-47 AT1G34210 215 / 2e-66 somatic embryogenesis receptor-like kinase 2 (.1) Lus10028716 [exp] 162 / 1e-46 AT1G71830 1000 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1) Lus10006057 [exp] 113 / 7e-29 AT1G71830 954 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G061600 [exp] 271 / 6e-93 AT5G21090 272 / 2e-93 Leucine-rich repeat (LRR) family protein (.1) Potri.003G166200 [exp] 264 / 2e-90 AT5G21090 275 / 2e-94 Leucine-rich repeat (LRR) family protein (.1) Potri.009G018800 [exp] 211 / 2e-69 AT5G21090 354 / 6e-126 Leucine-rich repeat (LRR) family protein (.1) Potri.001G219500 [exp] 203 / 2e-66 AT5G21090 348 / 2e-123 Leucine-rich repeat (LRR) family protein (.1) Potri.001G296500 [exp] 197 / 5e-64 AT3G43740 278 / 1e-95 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Potri.009G090700 [exp] 191 / 8e-62 AT3G43740 270 / 2e-92 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Potri.003G023000 [exp] 184 / 5e-55 AT4G33430 961 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) Potri.005G083300 [exp] 181 / 9e-54 AT1G71830 981 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1) Potri.001G206700 [exp] 180 / 2e-53 AT4G33430 927 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) Potri.007G082400 [exp] 179 / 4e-53 AT1G34210 954 / 0.0 somatic embryogenesis receptor-like kinase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat CL0022 [flax] [poplar] PF08263 [flax] [poplar] LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10001807 pacid=23140354 polypeptide=Lus10001807 locus=Lus10001807.g ID=Lus10001807.BGIv1.0 annot-version=v1.0 ATGGCTATCTGCATTTTCTTCAATCTCCTTCTCCTCCTAACTCTATCAATCATCGTAGCTCCTGCAACATCAAACCTCGAAGGGGATGCTCTGTACGCGC TGAGACTAGCAGTGAAGGACCCTGGACTTGTTCTCCAGAGCTGGGATCCTACCTTGGTTGACCCTTGCACTTGGTTCCACGTCACCTGCGATTCCCATGG CCGCATTACCCGACTGGACCTTGGGAATGCTAGGCTGTCTGGAAGGCTAGTCCCAGAGGTTGGCAAGTTGGAGCACCTTCAGTATCTGGAGTTGTACATG AATGAGCTGGTGGGGCCGATTCCAAAGGAGCTAGGAAACCTCAAGAATCTTATCAGCTTGGTTCTCTACCACAACAACCTTACTTCATCAATCCCGTCTT CCCTCTCCAATCATCCAGCCTCAAGTTCTTTTATGGGAAAATGTTGCATTCTGTGCAGACGGCTGAATGGTAACAGATTGACTGGAAGGATTCCTAGGCA GCTTACCAAGCTTCCAAGCCTCAAGATAGTTGATGTATCCAACAATGACTTGTGTGGTACAATCCCCACTTCTGGCTCGTTCTCCAAGCTCACTGAAGAA AGGTATGTCAAACTGGCGACTCACTGA
AA sequence Show only first row Show all	>Lus10001807 pacid=23140354 polypeptide=Lus10001807 locus=Lus10001807.g ID=Lus10001807.BGIv1.0 annot-version=v1.0 MAICIFFNLLLLLTLSIIVAPATSNLEGDALYALRLAVKDPGLVLQSWDPTLVDPCTWFHVTCDSHGRITRLDLGNARLSGRLVPEVGKLEHLQYLELYM NELVGPIPKELGNLKNLISLVLYHNNLTSSIPSSLSNHPASSSFMGKCCILCRRLNGNRLTGRIPRQLTKLPSLKIVDVSNNDLCGTIPTSGSFSKLTEE RYVKLATH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G21090			Leucine-rich repeat (LRR) fami...		Lus10001807 [exp]	0	1
AT3G13690			Protein kinase protein with ad...		Lus10001996 [exp]	3.7	0.8342
AT5G41850			alpha/beta-Hydrolases superfam...		Lus10021037 [exp]	10.8	0.8083
AT3G51630		ATWNK5, ZIK1, W...	with no lysine (K) kinase 5 (....		Lus10023776 [exp]	11.0	0.7788
AT2G39930		ATISA1, ISA1	ARABIDOPSIS THALIANA ISOAMYLAS...		Lus10017149 [exp]	12.4	0.8145
AT2G30320			Pseudouridine synthase family ...		Lus10026423 [exp]	23.6	0.7777
AT2G04940			scramblase-related (.1)		Lus10004532 [exp]	28.3	0.7512
AT2G14110			Haloacid dehalogenase-like hyd...		Lus10020444 [exp]	30.5	0.6982
AT1G78980		SRF5	STRUBBELIG-receptor family 5 (...		Lus10035703 [exp]	30.7	0.7257
AT1G52630			O-fucosyltransferase family pr...		Lus10026792 [exp]	31.2	0.7317
AT5G35360		CAC2	acetyl Co-enzyme a carboxylase...		Lus10042901 [exp]	34.3	0.7436

Compare expression of checked genes

Lus10001807 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.