Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23885 86 / 4e-24 unknown protein AT5G24165 72 / 2e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003881 [exp] 147 / 3e-47 AT4G23885 75 / 1e-18 unknown protein Lus10014921 [exp] 73 / 1e-18 AT5G24165 80 / 2e-21 unknown protein Lus10038814 [exp] 66 / 2e-14 AT5G38250 165 / 2e-46 Protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G140300 [exp] 105 / 1e-31 AT4G23885 85 / 2e-23 unknown protein Potri.012G011600 [exp] 64 / 4e-15 AT5G24165 89 / 4e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001827 pacid=23154500 polypeptide=Lus10001827 locus=Lus10001827.g ID=Lus10001827.BGIv1.0 annot-version=v1.0 ATGGCAGGAGTAGCACAGGCGTTGAAGCGAATCCCTCGCATCAAATTCCCCCAGCGCCATCTCAATCGTTCCTCAGGTTCCAACACAGAAGAAGCTTCCA ATGCTGGAACTGGCAGCTCAAGTTTCTTCTCCATTGCTAATGCTTCGAAATCCATCGGAGGTCAAGCTTCTCTCCAACCCAAACGATCGCCTGTTTCTAA CGATGAGATCCAGGCAATCTTGTTGGGCGGTTGCATCTGA
AA sequence Show only first row Show all	>Lus10001827 pacid=23154500 polypeptide=Lus10001827 locus=Lus10001827.g ID=Lus10001827.BGIv1.0 annot-version=v1.0 MAGVAQALKRIPRIKFPQRHLNRSSGSNTEEASNAGTGSSSFFSIANASKSIGGQASLQPKRSPVSNDEIQAILLGGCI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23885			unknown protein		Lus10001827 [exp]	0	1
AT4G34770			SAUR-like auxin-responsive pro...		Lus10012183 [exp]	4.6	0.9080
AT4G35210			Arabidopsis protein of unknown...		Lus10025122 [exp]	4.9	0.8977
AT2G18390		HAL, ARL2, TTN5...	TITAN 5, HALLIMASCH, ARF-LIKE ...		Lus10026383 [exp]	5.1	0.9094
AT3G53990			Adenine nucleotide alpha hydro...		Lus10022602 [exp]	6.4	0.9189
AT3G06890			unknown protein		Lus10037501 [exp]	7.1	0.8751
AT1G20575		DPMS1	dolichol phosphate mannose syn...		Lus10030748 [exp]	10.5	0.8885
AT5G03345			unknown protein		Lus10026529 [exp]	10.5	0.8877
AT1G13770		RUS3	ROOT UV-B SENSITIVE 3, Protein...		Lus10036909 [exp]	12.8	0.8702
AT1G03220			Eukaryotic aspartyl protease f...		Lus10041223 [exp]	14.5	0.8845
AT3G53140			O-methyltransferase family pro...		Lus10023892 [exp]	14.7	0.9016

Compare expression of checked genes

Lus10001827 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.