Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003882 [exp] 151 / 2e-48 ND 35 / 0.004 Lus10003883 [exp] 119 / 5e-36 ND / Lus10023083 [exp] 62 / 4e-13 ND 36 / 0.005 Lus10023082 [exp] 61 / 6e-13 ND / Lus10032385 [exp] 57 / 2e-11 ND 39 / 1e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G140100 [exp] 64 / 3e-14 AT1G64405 42 / 5e-06 unknown protein Potri.001G091500 [exp] 62 / 2e-13 AT1G64405 42 / 5e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001828 pacid=23154492 polypeptide=Lus10001828 locus=Lus10001828.g ID=Lus10001828.BGIv1.0 annot-version=v1.0 ATGGGGAATTGCTTAAGATCAAGCAAGCTAAGCAGCCAAGTGCACGATGTGGAACAACAACATGATGATCAGTTCAGCACTTCTCACCCACGGCAACAGA AGAAGTCATCATCATCAGGGGATCATAATAGTGATGATGAAGGGACGAAAGTGAAGGTAGTTTTGACGAAGGAAGAGCTAGAGTGGCTGATGCACGAGCT CAAAGTGAATAATAGAAAGCTTGAAGAAGCTCTGGCTGAGATCCAAAGAAGCAGAGCATTGAAATCCATTATTATTATTGCTACTGCTGGTAATCATAAC AACTGTTGGCGGCCTTCTTTGGAGAGCATTTCTGAAGACGACCTTGATGAATGA
AA sequence Show only first row Show all	>Lus10001828 pacid=23154492 polypeptide=Lus10001828 locus=Lus10001828.g ID=Lus10001828.BGIv1.0 annot-version=v1.0 MGNCLRSSKLSSQVHDVEQQHDDQFSTSHPRQQKKSSSSGDHNSDDEGTKVKVVLTKEELEWLMHELKVNNRKLEEALAEIQRSRALKSIIIIATAGNHN NCWRPSLESISEDDLDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10001828 [exp]	0	1
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10023208 [exp]	1.4	0.9040
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10008897 [exp]	2.4	0.8838
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10008419 [exp]	3.5	0.8496
AT3G13750		BGAL1	beta-galactosidase 1, beta gal...		Lus10037644 [exp]	6.9	0.8512
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10003367 [exp]	7.1	0.8313
					Lus10025831 [exp]	9.8	0.8253
AT5G04530		KCS19	3-ketoacyl-CoA synthase 19 (.1...		Lus10039906 [exp]	12.2	0.7686
					Lus10017461 [exp]	12.4	0.7491
AT3G24140	bHLH	bHLH097, FMA	FAMA, basic helix-loop-helix (...		Lus10016680 [exp]	13.5	0.8066
AT2G26250		KCS10, FDH	FIDDLEHEAD, 3-ketoacyl-CoA syn...		Lus10016528 [exp]	20.2	0.7881

Compare expression of checked genes

Lus10001828 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.