Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33355 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G59320 62 / 3e-13 LTP3 lipid transfer protein 3 (.1) AT2G38530 58 / 7e-12 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT2G15050 58 / 8e-12 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT2G18370 58 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G59310 57 / 3e-11 LTP4 lipid transfer protein 4 (.1) AT3G51600 57 / 3e-11 LTP5 lipid transfer protein 5 (.1) AT3G51590 52 / 2e-09 LTP12 lipid transfer protein 12 (.1) AT3G08770 50 / 1e-08 LTP6 lipid transfer protein 6 (.1.2) AT2G38540 49 / 2e-08 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003884 [exp] 214 / 5e-73 AT4G33355 72 / 6e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10023087 [exp] 129 / 1e-39 AT4G33355 69 / 8e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032381 [exp] 128 / 1e-36 AT5G62050 270 / 4e-87 HOMOLOG OF YEAST OXIDASE ASSEMBLY 1 \(OXA1\) IN ARABIDOPSIS THALIANA, ARABIDOPSIS THALIANA HOMOLOG OF YEAST OXIDASE ASSEMBLY 1 \(OXA1\), homolog of yeast oxidase assembly 1 (OXA1) (.1) Lus10014167 [exp] 71 / 2e-16 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10022745 [exp] 69 / 5e-16 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10012384 [exp] 66 / 5e-15 AT5G59310 76 / 4e-19 lipid transfer protein 4 (.1) Lus10026418 [exp] 66 / 1e-14 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10015279 [exp] 65 / 1e-14 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10007280 [exp] 64 / 7e-14 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G046500 [exp] 72 / 5e-17 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.014G098000 [exp] 68 / 2e-15 AT5G59310 71 / 9e-17 lipid transfer protein 4 (.1) Potri.004G086600 [exp] 63 / 1e-13 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 62 / 2e-13 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.011G021900 [exp] 62 / 4e-13 AT3G08770 60 / 8e-13 lipid transfer protein 6 (.1.2) Potri.001G232700 [exp] 60 / 1e-12 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 60 / 2e-12 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.011G022150 [exp] 57 / 3e-11 AT3G51590 54 / 2e-10 lipid transfer protein 12 (.1) Potri.006G108100 [exp] 56 / 8e-11 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135700 [exp] 55 / 1e-10 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10001829 pacid=23154507 polypeptide=Lus10001829 locus=Lus10001829.g ID=Lus10001829.BGIv1.0 annot-version=v1.0 ATGGCGAGTCGTTACTTGACAGTAGTTGTGGTGGCGATGTTCTTAGTGGGACTGCAGGTGGTGATGGGAGCTAGCTATAGGAGACAGCTGCTGCAGGCAG CGCCGTCTTGCCCCGCAATCTACGCCGACTTGAGGCCATGCACGCCTTACTTGACGGGAAGGAACGGAGATCCGTCGAGACAATGCTGCAGCGGGGTGGG TGAACTTCAGCCTTACTCCAGGCGGAAGTCGGACAGGGTAGAGATCTGCCAGTGCCTTAAGTCCTTAGCCATCCTCGTTCCAGGCCTTGACTTGTCCGTC GCCTCTAAGCTCCCCAAGAAGTGTAAAGTCAATGTCAAGCTCCCCAAGCTTTCTCTCAACATCGACTGTTCCAAGGCTTGA
AA sequence Show only first row Show all	>Lus10001829 pacid=23154507 polypeptide=Lus10001829 locus=Lus10001829.g ID=Lus10001829.BGIv1.0 annot-version=v1.0 MASRYLTVVVVAMFLVGLQVVMGASYRRQLLQAAPSCPAIYADLRPCTPYLTGRNGDPSRQCCSGVGELQPYSRRKSDRVEICQCLKSLAILVPGLDLSV ASKLPKKCKVNVKLPKLSLNIDCSKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33355			Bifunctional inhibitor/lipid-t...		Lus10001829 [exp]	0	1
					Lus10009727 [exp]	3.2	1.0000
AT4G35260		IDH-I, IDH1	isocitrate dehydrogenase I, is...		Lus10023937 [exp]	5.1	1.0000
AT5G22450			unknown protein		Lus10000530 [exp]	5.7	1.0000
					Lus10003082 [exp]	10.0	1.0000
					Lus10003536 [exp]	10.1	1.0000
AT4G17220		ATMAP70-5	microtubule-associated protein...		Lus10003908 [exp]	11.5	1.0000
					Lus10011642 [exp]	13.2	1.0000
					Lus10011425 [exp]	14.9	1.0000
					Lus10011832 [exp]	15.0	1.0000
					Lus10022214 [exp]	15.0	1.0000

Compare expression of checked genes

Lus10001829 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.