Lus10001848 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G14310 100 / 5e-25 ATPME3 pectin methylesterase 3 (.1)
AT1G53830 90 / 2e-21 ATPME2 pectin methylesterase 2 (.1)
AT5G20740 57 / 3e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 57 / 5e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G53840 55 / 3e-09 ATPME1 pectin methylesterase 1 (.1)
AT5G62360 52 / 1e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G05620 52 / 5e-08 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G02320 50 / 1e-07 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G62770 50 / 1e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G02330 50 / 1e-07 AtPME41, ATPMEPCRB pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013344 231 / 6e-74 AT3G14310 698 / 0.0 pectin methylesterase 3 (.1)
Lus10037458 96 / 2e-23 AT3G14310 491 / 2e-170 pectin methylesterase 3 (.1)
Lus10039314 86 / 5e-20 AT3G14310 702 / 0.0 pectin methylesterase 3 (.1)
Lus10003933 79 / 2e-17 AT3G14310 733 / 0.0 pectin methylesterase 3 (.1)
Lus10001466 70 / 2e-14 AT4G02300 299 / 1e-105 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10027556 67 / 2e-14 AT1G53830 161 / 2e-47 pectin methylesterase 2 (.1)
Lus10028910 62 / 8e-12 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 57 / 2e-10 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 57 / 3e-10 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G072800 107 / 2e-27 AT3G14310 795 / 0.0 pectin methylesterase 3 (.1)
Potri.001G162400 106 / 3e-27 AT3G14310 792 / 0.0 pectin methylesterase 3 (.1)
Potri.018G051400 101 / 2e-25 AT3G14310 708 / 0.0 pectin methylesterase 3 (.1)
Potri.002G202500 68 / 1e-13 AT4G02320 576 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.015G128100 63 / 1e-12 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 63 / 1e-12 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 62 / 3e-12 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 59 / 5e-11 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 58 / 7e-11 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.006G137800 58 / 1e-10 AT5G20740 205 / 2e-67 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10001848 pacid=23158790 polypeptide=Lus10001848 locus=Lus10001848.g ID=Lus10001848.BGIv1.0 annot-version=v1.0
ATGGCCTGGTCGGAGTCAAACCGAACCAAAAATATCTTCCTACTATTCACCTTCTCCGCCGCCATCCTCATTACCGCCGCCGCCGCCACAGTACACCACG
CCGTCATAAAATCATCATGCAGCACAACACTCAACCCAGAGCTCTGCCACTCCGCCGCCATCTCTTCTCTCCCTTTCGCCGCCTTAACCAACATCAAGAC
AATAACCGACGTGTTGGACCTATCCCTAAACGCAACAATCGCCGCCGTACAAGCAAACGAGCAAGCCATCAAGAAAATCATCTCCTCCTGCAGCCTTACC
CTGACGAAGCGGGAGAAGGCGGCCCTGGCCGACTGTGTCGAGCTTTGCGGCGAGACGATGAACGAGCTCGTGAAGACGATTGAGGAGCTTCATGGGAGCA
AGAATTCGGCGGCAGAGAGAGGGGAGGATCTGAAGACGCTGCTGAGCGCTGCGATGACGAACCAGGAGACTTGTCTCGATGTGTTAGATGATGTTAAATT
ATAG
AA sequence
>Lus10001848 pacid=23158790 polypeptide=Lus10001848 locus=Lus10001848.g ID=Lus10001848.BGIv1.0 annot-version=v1.0
MAWSESNRTKNIFLLFTFSAAILITAAAATVHHAVIKSSCSTTLNPELCHSAAISSLPFAALTNIKTITDVLDLSLNATIAAVQANEQAIKKIISSCSLT
LTKREKAALADCVELCGETMNELVKTIEELHGSKNSAAERGEDLKTLLSAAMTNQETCLDVLDDVKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G14310 ATPME3 pectin methylesterase 3 (.1) Lus10001848 0 1
AT5G46090 Protein of unknown function (D... Lus10015396 3.2 0.8788
AT4G28320 MAN5, AtMAN5 endo-beta-mannase 5, Glycosyl ... Lus10039719 11.0 0.8330
Lus10033476 21.2 0.7953
Lus10011047 26.0 0.8071
AT4G14740 Plant protein of unknown funct... Lus10002798 26.6 0.8044
AT3G14470 NB-ARC domain-containing disea... Lus10022900 40.2 0.7523
AT5G39710 EMB2745 EMBRYO DEFECTIVE 2745, Tetratr... Lus10022739 40.7 0.7616
AT2G32180 PTAC18 plastid transcriptionally acti... Lus10035307 40.9 0.7875
AT3G47570 Leucine-rich repeat protein ki... Lus10017400 48.1 0.7683
AT4G37340 CYP81D3 "cytochrome P450, family 81, s... Lus10024973 54.8 0.7340

Lus10001848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.