Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05750 97 / 3e-25 PDE247, CLB19 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G57430 86 / 4e-21 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G29230 82 / 8e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G56310 81 / 2e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G09950 79 / 8e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G09040 79 / 8e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G22690 76 / 9e-18 unknown protein AT2G29760 76 / 2e-17 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G40410 75 / 2e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G01510 75 / 3e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013341 [exp] 171 / 6e-53 AT1G05750 525 / 0.0 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10001220 [exp] 83 / 5e-20 AT3G57430 1110 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10035788 [exp] 81 / 2e-19 AT3G16610 636 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10040680 [exp] 81 / 2e-19 AT2G29760 926 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10038400 [exp] 80 / 4e-19 AT3G57430 1097 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030053 [exp] 79 / 8e-19 AT1G08070 884 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10037362 [exp] 78 / 2e-18 AT3G57430 477 / 9e-158 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10001617 [exp] 78 / 3e-18 AT2G03880 840 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10018223 [exp] 77 / 4e-18 AT2G29760 931 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G217600 [exp] 108 / 2e-29 AT1G05750 548 / 0.0 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G237000 [exp] 88 / 7e-22 AT5G66520 544 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G027800 [exp] 82 / 7e-20 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G075800 [exp] 81 / 3e-19 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G369900 [exp] 80 / 5e-19 AT5G66520 512 / 2e-175 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.017G001000 [exp] 79 / 7e-19 AT4G21065 793 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.001G019500 [exp] 79 / 8e-19 AT2G22410 791 / 0.0 SLOW GROWTH 1 (.1) Potri.017G042100 [exp] 79 / 9e-19 AT4G32430 803 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G128900 [exp] 79 / 1e-18 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G105700 [exp] 79 / 1e-18 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001853 pacid=23158794 polypeptide=Lus10001853 locus=Lus10001853.g ID=Lus10001853.BGIv1.0 annot-version=v1.0 ATGAACAGGATTATTGACTTGGAGCCTGGAGTTGACTCGAATTACGTGATTCTCGCGAATCTTTATGCAGCTGCGGGGAAATGGGAAGGGGCGAGTAAGG TGAGGAGGAGAATGAAGGAAGCTGGTGTGAGGAAGACTGTGGGGTTTAGTTCGGTAGAAGTCGAGTCTGGGATTCATGAGTTTGTAGCTGGTGATAAGTC TCATTGTGAAGTTGAGCGTATAAACGAGATGCTGGAGCTTCTGAGGTTCGAGTTGAAGTAG
AA sequence Show only first row Show all	>Lus10001853 pacid=23158794 polypeptide=Lus10001853 locus=Lus10001853.g ID=Lus10001853.BGIv1.0 annot-version=v1.0 MNRIIDLEPGVDSNYVILANLYAAAGKWEGASKVRRRMKEAGVRKTVGFSSVEVESGIHEFVAGDKSHCEVERINEMLELLRFELK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G05750		PDE247, CLB19	pigment defective 247, Tetratr...		Lus10001853 [exp]	0	1
AT4G26780		MGE2, AR192	mitochondrial GrpE 2, Co-chape...		Lus10032565 [exp]	3.9	0.7570
AT3G46790		CRR2	CHLORORESPIRATORY REDUCTION 2,...		Lus10001557 [exp]	3.9	0.7180
AT3G45770			Polyketide synthase, enoylredu...		Lus10020161 [exp]	13.4	0.7313
AT1G34160			Tetratricopeptide repeat (TPR)...		Lus10004197 [exp]	21.0	0.6909
					Lus10025864 [exp]	23.0	0.6507
AT1G69210			Uncharacterised protein family...		Lus10026674 [exp]	26.8	0.7010
AT1G69680			Mog1/PsbP/DUF1795-like photosy...		Lus10012837 [exp]	30.3	0.6905
AT1G01170			Protein of unknown function (D...		Lus10042373 [exp]	32.9	0.6859
AT2G39170			unknown protein		Lus10018298 [exp]	33.8	0.6284
AT2G21090			Pentatricopeptide repeat (PPR-...		Lus10027836 [exp]	36.0	0.5555

Compare expression of checked genes

Lus10001853 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.