Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27250 39 / 6e-05 AtCLV3, CLV3 CLAVATA3 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013340 [exp] 84 / 2e-22 AT2G27250 42 / 4e-06 CLAVATA3 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G020300 [exp] 47 / 7e-08 AT2G27250 41 / 1e-05 CLAVATA3 (.1.2.3) Potri.001G217500 [exp] 45 / 6e-07 AT2G27250 40 / 2e-05 CLAVATA3 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001854 pacid=23158784 polypeptide=Lus10001854 locus=Lus10001854.g ID=Lus10001854.BGIv1.0 annot-version=v1.0 ATGGCCGCACGACGTACAAACTCCAACAAGCTCCTACTTATAAGTTTCATACTCATTACAGCCATGCTACTCTGTTCTTCATCTCTCACTCTTGCTGCCA GTACAGATTCCATGTTTCCTCATGCTGCTGCTGGCCGAACCAGAAAGGTTCTGGTTAGGGTGGCCAAGGATCAGGTGGGTTGTACCTATAAGGAAGAGTT GAGAACAGTTCCTTCAGGGCCAGACCCTTTGCATCATAATGGTGGAACTCCCAACAAGAAACCCAGACCTAGTTCTCCTTGCAATCTCTGCATGCTTCAG TTTTTAGGCACCTACTTGTGGAATATGTTTCATGTTCATGCATGCAGCTAG
AA sequence Show only first row Show all	>Lus10001854 pacid=23158784 polypeptide=Lus10001854 locus=Lus10001854.g ID=Lus10001854.BGIv1.0 annot-version=v1.0 MAARRTNSNKLLLISFILITAMLLCSSSLTLAASTDSMFPHAAAGRTRKVLVRVAKDQVGCTYKEELRTVPSGPDPLHHNGGTPNKKPRPSSPCNLCMLQ FLGTYLWNMFHVHACS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10001854 [exp]	0	1
					Lus10010663 [exp]	7.7	0.9999
AT2G21650	MYB	RSM1, ATRL2, ME...	RADIALIS-LIKE SANT/MYB 1, MATE...		Lus10040453 [exp]	7.8	0.9982
					Lus10038209 [exp]	7.9	0.9982
AT5G64820			unknown protein		Lus10025572 [exp]	10.9	0.9999
AT1G22130	MADS	AGL104	AGAMOUS-like 104 (.1)		Lus10016810 [exp]	12.4	0.9850
					Lus10014229 [exp]	13.3	0.9999
AT2G48020			Major facilitator superfamily ...		Lus10027977 [exp]	13.6	0.9635
					Lus10027902 [exp]	14.5	0.9917
AT2G39518			Uncharacterised protein family...		Lus10031304 [exp]	15.4	0.9999
AT4G03230			S-locus lectin protein kinase ...		Lus10031602 [exp]	17.2	0.9999

Compare expression of checked genes

Lus10001854 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.