Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G22930 81 / 7e-19 UDP-Glycosyltransferase superfamily protein (.1) AT4G27570 79 / 4e-18 UDP-Glycosyltransferase superfamily protein (.1) AT5G54060 75 / 8e-17 UF3GT UDP-glucose:flavonoid 3-o-glucosyltransferase (.1) AT4G09500 75 / 1e-16 UDP-Glycosyltransferase superfamily protein (.1.2) AT4G27560 74 / 1e-16 UDP-Glycosyltransferase superfamily protein (.1) AT3G29630 72 / 7e-16 UDP-Glycosyltransferase superfamily protein (.1) AT5G54010 72 / 1e-15 UDP-Glycosyltransferase superfamily protein (.1) AT5G53990 68 / 2e-14 UDP-Glycosyltransferase superfamily protein (.1) AT1G64920 66 / 1e-13 UDP-Glycosyltransferase superfamily protein (.1) AT1G64910 65 / 2e-13 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013337 [exp] 136 / 3e-39 AT5G54010 452 / 1e-156 UDP-Glycosyltransferase superfamily protein (.1) Lus10008453 [exp] 81 / 6e-19 AT5G54010 539 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Lus10004381 [exp] 80 / 2e-18 AT5G54060 437 / 1e-150 UDP-glucose:flavonoid 3-o-glucosyltransferase (.1) Lus10040178 [exp] 79 / 3e-18 AT5G54010 437 / 7e-151 UDP-Glycosyltransferase superfamily protein (.1) Lus10000643 [exp] 53 / 5e-09 AT1G69170 192 / 4e-55 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) Lus10003154 [exp] 53 / 5e-09 AT5G54010 318 / 3e-104 UDP-Glycosyltransferase superfamily protein (.1) Lus10002350 [exp] 49 / 1e-07 AT1G64910 179 / 2e-54 UDP-Glycosyltransferase superfamily protein (.1) Lus10008955 [exp] 48 / 3e-07 AT5G49690 190 / 4e-55 UDP-Glycosyltransferase superfamily protein (.1) Lus10014082 [exp] 47 / 5e-07 AT2G15480 483 / 3e-168 UDP-glucosyl transferase 73B5 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G097900 [exp] 82 / 3e-19 AT5G54010 498 / 1e-174 UDP-Glycosyltransferase superfamily protein (.1) Potri.011G061000 [exp] 75 / 7e-17 AT5G54010 468 / 6e-163 UDP-Glycosyltransferase superfamily protein (.1) Potri.017G041900 [exp] 69 / 1e-14 AT5G54010 348 / 1e-116 UDP-Glycosyltransferase superfamily protein (.1) Potri.014G088400 [exp] 54 / 2e-09 AT2G22590 374 / 4e-125 UDP-Glycosyltransferase superfamily protein (.1) Potri.006G179700 [exp] 54 / 2e-09 AT5G54010 349 / 2e-116 UDP-Glycosyltransferase superfamily protein (.1) Potri.001G030600 [exp] 52 / 1e-08 AT2G22590 537 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Potri.017G091500 [exp] 50 / 3e-08 AT3G02100 454 / 9e-158 UDP-Glycosyltransferase superfamily protein (.1) Potri.003G184400 [exp] 50 / 5e-08 AT5G49690 549 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Potri.010G182575 [exp] 47 / 3e-07 AT5G49690 468 / 7e-163 UDP-Glycosyltransferase superfamily protein (.1) Potri.004G123500 [exp] 47 / 5e-07 AT3G02100 439 / 9e-152 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001858 pacid=23158792 polypeptide=Lus10001858 locus=Lus10001858.g ID=Lus10001858.BGIv1.0 annot-version=v1.0 ATGAATCGGTTTGGGTGCAGAGAGCTCCTGAACGGCTTCGAGATATGCGGGCACCCATTCCTGGCAGCACTGAAGCCACCGCCGGGGTGTTCGACGGCGG AGGAGGCGTTTCCAGAAGGGTTTGAGGAGAAGGTAAGGGGAAGAGGCTGGGTCACCAGCGGGTGGGTCCGGCAGCGTCGGATTCTGGACCATGCATCGAT AATGGGAACGATGCTGATGGTCAAGGAGCTCAAGGTGGCCGTGGAAGTGGAGAAGATCAAGTCCGGTGGCCGGTGGTGGATTGCGAAGGAGAAGCTGAAT GAGGCTATCAGGGCTGTGATGGTGATGGTGATGGTGAAGTTGGTGGAGAAGTGA
AA sequence Show only first row Show all	>Lus10001858 pacid=23158792 polypeptide=Lus10001858 locus=Lus10001858.g ID=Lus10001858.BGIv1.0 annot-version=v1.0 MNRFGCRELLNGFEICGHPFLAALKPPPGCSTAEEAFPEGFEEKVRGRGWVTSGWVRQRRILDHASIMGTMLMVKELKVAVEVEKIKSGGRWWIAKEKLN EAIRAVMVMVMVKLVEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27570			UDP-Glycosyltransferase superf...		Lus10001858 [exp]	0	1
AT5G62140			unknown protein		Lus10038887 [exp]	2.4	0.8718
AT5G59090		ATSBT4.12	subtilase 4.12 (.1.2.3)		Lus10040253 [exp]	3.7	0.8434
AT1G25570			Di-glucose binding protein wit...		Lus10041488 [exp]	7.5	0.8116
AT4G31540		ATEXO70G1	exocyst subunit exo70 family p...		Lus10018672 [exp]	8.7	0.8295
AT1G09850		XBCP3	xylem bark cysteine peptidase ...		Lus10024296 [exp]	8.9	0.8044
AT3G22190		IQD5	IQ-domain 5 (.1.2)		Lus10013362 [exp]	10.5	0.8245
AT3G13040	GARP		myb-like HTH transcriptional r...		Lus10037296 [exp]	11.0	0.7873
AT2G34930			disease resistance family prot...		Lus10001035 [exp]	13.3	0.8298
AT2G38900			Serine protease inhibitor, pot...		Lus10003225 [exp]	17.7	0.8193
AT5G52390			PAR1 protein (.1)		Lus10040702 [exp]	19.0	0.7465

Compare expression of checked genes

Lus10001858 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.