Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54140 104 / 3e-30 TAF9, TAFII21 TBP-ASSOCIATED FACTOR 9, TATA binding protein associated factor 21kDa subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011251 [exp] 120 / 2e-36 AT1G54140 242 / 2e-82 TBP-ASSOCIATED FACTOR 9, TATA binding protein associated factor 21kDa subunit (.1) Lus10012411 [exp] 119 / 4e-36 AT1G54140 239 / 2e-81 TBP-ASSOCIATED FACTOR 9, TATA binding protein associated factor 21kDa subunit (.1) Lus10022103 [exp] 110 / 4e-34 AT1G54140 112 / 2e-33 TBP-ASSOCIATED FACTOR 9, TATA binding protein associated factor 21kDa subunit (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G168300 [exp] 109 / 3e-32 AT1G54140 262 / 1e-90 TBP-ASSOCIATED FACTOR 9, TATA binding protein associated factor 21kDa subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF02291 [flax] [poplar] TFIID-31kDa Transcription initiation factor IID, 31kD subunit
Representative CDS sequence Show only first row Show all	>Lus10001863 pacid=23169986 polypeptide=Lus10001863 locus=Lus10001863.g ID=Lus10001863.BGIv1.0 annot-version=v1.0 ATGGCCGAAGGAGATGAGCAAATGCCAAGAGATGCGAAGATTGTGAAATCATTCCTGAAATCAATGGGTGTTGAAGACTACGAACCTCGTGTTATCCACA ACTTCCTGGAATTGTGGTATTGTTACGCGGTGGACTGGTTGACAGATGCTCAAGTTTACTCGGAGCATGCTGGGAAGTCAAACTTGCCATTCAATCCAGA GTAA
AA sequence Show only first row Show all	>Lus10001863 pacid=23169986 polypeptide=Lus10001863 locus=Lus10001863.g ID=Lus10001863.BGIv1.0 annot-version=v1.0 MAEGDEQMPRDAKIVKSFLKSMGVEDYEPRVIHNFLELWYCYAVDWLTDAQVYSEHAGKSNLPFNPE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G54140		TAF9, TAFII21	TBP-ASSOCIATED FACTOR 9, TATA ...		Lus10001863 [exp]	0	1
AT3G01570			Oleosin family protein (.1)		Lus10003742 [exp]	1.0	0.9146
AT3G55610		P5CS2	delta 1-pyrroline-5-carboxylat...		Lus10005468 [exp]	1.4	0.8175
AT3G28470	MYB	TDF1, ATMYB35	DEFECTIVE IN MERISTEM DEVELOPM...		Lus10036660 [exp]	2.6	0.7772
AT3G05950			RmlC-like cupins superfamily p...		Lus10041900 [exp]	3.2	0.7823
					Lus10020703 [exp]	4.7	0.7460
AT2G24190		SDR2	short-chain dehydrogenase/redu...		Lus10008413 [exp]	5.5	0.7555
					Lus10025367 [exp]	6.9	0.7174
AT1G28220		ATPUP3	purine permease 3 (.1)		Lus10008212 [exp]	14.6	0.8153
					Lus10022394 [exp]	15.2	0.7990
AT5G16100			unknown protein		Lus10004035 [exp]	18.3	0.6763

Compare expression of checked genes

Lus10001863 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.