Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G24440 201 / 5e-69 transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) (.1), transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032829 [exp] 120 / 6e-33 AT4G24450 1571 / 0.0 "phosphoglucan, water dikinase", phosphoglucan, water dikinase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G151700 [exp] 206 / 1e-70 AT4G24440 204 / 4e-70 transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) (.1), transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02751 [flax] [poplar] TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit PF02268 [flax] [poplar] TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
Representative CDS sequence Show only first row Show all	>Lus10001864 pacid=23149325 polypeptide=Lus10001864 locus=Lus10001864.g ID=Lus10001864.BGIv1.0 annot-version=v1.0 ATGGCGACGTTTGAGCTCTACAGAAGATCGACCATCGGCATGTGCCTGACGGAGACTTTGGACGAGATGGTTTCGAGTGGTACTCTCAGTCCGGAGCTCG CGATCCAAGTCCTTGTTCAGTTCGATAAGTCCATGACTGACGCATTGGACACACAAGTGAAGAGCAAGGTCACAATCAAGGGACATTTACACACATACAG GTTCTGCGACAACGTATGGACGTTCATATTGCAGGATGCACTGTTCAAGAATGAAGAAACGCAGGAGAATGTGGGGCGGGTGAAAATAGTAGCATGTGAT TCGAAGCTGCTCACGCAATGA
AA sequence Show only first row Show all	>Lus10001864 pacid=23149325 polypeptide=Lus10001864 locus=Lus10001864.g ID=Lus10001864.BGIv1.0 annot-version=v1.0 MATFELYRRSTIGMCLTETLDEMVSSGTLSPELAIQVLVQFDKSMTDALDTQVKSKVTIKGHLHTYRFCDNVWTFILQDALFKNEETQENVGRVKIVACD SKLLTQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G24440			transcription initiation facto...		Lus10001864 [exp]	0	1
AT4G16060			unknown protein		Lus10016832 [exp]	29.4	0.6328
					Lus10007590 [exp]	35.2	0.6448
AT5G44450			methyltransferases (.1)		Lus10042846 [exp]	47.0	0.5779
AT5G63440			Protein of unknown function (D...		Lus10022455 [exp]	47.7	0.6073
AT5G06920		FLA21	FASCICLIN-like arabinogalactan...		Lus10039717 [exp]	55.3	0.6290
AT2G34050			unknown protein		Lus10020428 [exp]	72.1	0.5993
AT2G44430			DNA-binding bromodomain-contai...		Lus10021861 [exp]	72.8	0.6393
					Lus10014959 [exp]	76.2	0.6181
					Lus10025813 [exp]	85.8	0.6281
AT5G20130			unknown protein		Lus10037880 [exp]	90.5	0.5952

Compare expression of checked genes

Lus10001864 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.