Plant FIBer expression Database

Lus10001872 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62170 43 / 1e-05 Serine protease inhibitor (SERPIN) family protein (.1), Serine protease inhibitor (SERPIN) family protein (.2)
AT3G45220 38 / 0.0007 Serine protease inhibitor (SERPIN) family protein (.1)
AT2G25240 37 / 0.0007 Serine protease inhibitor (SERPIN) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019009
[exp]
47 / 5e-07 AT1G47710 209 / 9e-64 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10039336
[exp]
44 / 5e-06 AT2G26390 105 / 2e-25 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10032754
[exp]
39 / 0.0002 AT1G47710 487 / 1e-172 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10002792
[exp]
39 / 0.0002 AT1G47710 495 / 6e-176 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10016386
[exp]
37 / 0.0005 ND 43 / 3e-06
Poplar homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00079 Serpin Serpin (serine protease inhibitor)
Representative CDS sequence
>Lus10001872 pacid=23181639 polypeptide=Lus10001872 locus=Lus10001872.g ID=Lus10001872.BGIv1.0 annot-version=v1.0
ATGAAGAAGGTGGATGCCCAAGAGAACAAGGAGGAGAAGGTGTTGGGAGTAGGGCTGCAAGAAGAACAAGGGATAGGTCATAGGAAGTGGAAAGTAGGCT
TGTCAAGCGAACTGTTACATGTAGCAAATATGGTAATAGAGGTCATAATTCATGCCACTGCCTACCAGCGTGTTTTCATCAGGTACTGGAATGTGGATGA
GAAAGGTACAAAGGCTGCAGCTGTCACCATAGTGGATTGTGAATTATGGATGTGTAACTCACCAAAACAACCGATAGATGATTTTATTGCAGACCATCCT
TTCATATTCTTGATAATGGAAAAATGA
AA sequence
>Lus10001872 pacid=23181639 polypeptide=Lus10001872 locus=Lus10001872.g ID=Lus10001872.BGIv1.0 annot-version=v1.0
MKKVDAQENKEEKVLGVGLQEEQGIGHRKWKVGLSSELLHVANMVIEVIIHATAYQRVFIRYWNVDEKGTKAAAVTIVDCELWMCNSPKQPIDDFIADHP
FIFLIMEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001872
[exp]
0 1
AT1G31670 Copper amine oxidase family pr... Lus10010539
[exp]
1.0 0.9993
AT3G05950 RmlC-like cupins superfamily p... Lus10038456
[exp]
2.4 0.9956
AT3G15670 Late embryogenesis abundant pr... Lus10004395
[exp]
3.2 0.9732
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10019783
[exp]
3.5 0.9831
Lus10004634
[exp]
4.5 0.9779
AT5G07050 nodulin MtN21 /EamA-like trans... Lus10041634
[exp]
5.5 0.9439
AT3G19550 unknown protein Lus10002115
[exp]
8.4 0.9613
AT3G48280 CYP71A25 "cytochrome P450, family 71, s... Lus10040120
[exp]
10.3 0.8948
AT3G19550 unknown protein Lus10002114
[exp]
12.7 0.9442
AT3G62040 Haloacid dehalogenase-like hyd... Lus10037859
[exp]
14.4 0.9062

Lus10001872 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.