Lus10001873 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12560 45 / 2e-05 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
AT3G21410 44 / 4e-05 F-box and associated interaction domains-containing protein (.1)
AT3G07870 42 / 0.0002 F-box and associated interaction domains-containing protein (.1)
AT3G23880 41 / 0.0005 F-box and associated interaction domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018106 116 / 2e-30 AT3G06240 95 / 3e-21 F-box family protein (.1)
Lus10023239 57 / 3e-09 AT3G23880 130 / 3e-34 F-box and associated interaction domains-containing protein (.1)
Lus10008870 55 / 2e-08 AT3G23880 126 / 9e-33 F-box and associated interaction domains-containing protein (.1)
Lus10011015 54 / 2e-08 AT3G06240 94 / 7e-21 F-box family protein (.1)
Lus10022410 52 / 9e-08 AT2G31305 104 / 1e-27 inhibitor-3 (.1)
Lus10023238 52 / 1e-07 AT3G23880 126 / 6e-33 F-box and associated interaction domains-containing protein (.1)
Lus10008871 52 / 1e-07 AT4G12560 135 / 1e-35 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Lus10018972 51 / 3e-07 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10039593 50 / 3e-07 AT4G12560 75 / 9e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G014300 67 / 9e-13 AT3G16210 88 / 6e-19 F-box family protein (.1)
Potri.015G013500 57 / 3e-09 AT4G10190 70 / 4e-13 F-box and associated interaction domains-containing protein (.1)
Potri.001G035500 56 / 6e-09 AT4G12560 271 / 3e-87 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.015G013800 56 / 7e-09 AT4G12560 105 / 7e-25 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.017G012200 54 / 2e-08 AT4G12560 86 / 4e-18 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.012G099733 50 / 3e-07 AT3G16210 92 / 2e-20 F-box family protein (.1)
Potri.001G318400 49 / 1e-06 AT3G06240 142 / 3e-38 F-box family protein (.1)
Potri.005G114900 47 / 7e-06 AT3G21410 73 / 9e-14 F-box and associated interaction domains-containing protein (.1)
Potri.006G013000 45 / 2e-05 AT4G12560 250 / 5e-79 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.010G207500 44 / 6e-05 AT4G12560 94 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10001873 pacid=23181646 polypeptide=Lus10001873 locus=Lus10001873.g ID=Lus10001873.BGIv1.0 annot-version=v1.0
ATGAAATCACTTCGAGAGGACATGGTGATCGACATATTCACTCGGTTACCAGATGATGATGATGATGAGCTGATAATGTTGGCTATCCAAACCAACAACA
ATGACGATGATGATGAGTTGATAATGTCGACTATCCAAACCAATAACAACGATGATGATGAGCTGATAATGTCGGCTATTCAAACAAACAACATCAACTA
CTTCCCAACCATCAATCGGAATTTGGTCGTACCCGTCAAGTCACCATACTCAATTGTGGGTTCCTGTAACGGCTTGCTAATCCTATACATGCAATTCAAC
CCAACTGCCAAGTTCGCGTTGTGGAATCCGGCTACCAATGAATTTGGATGGGTACCCGATTTGGATCTTAGATCCCCATTCTCTGACCTAATCACAAGAA
GGTTTTCCATCTGCGAGAGCTTTGGGTTCGGGTTTGATGTCATTGCTACTGACTATAAGTTCGTAAAGTTCGTGAGCTTTTACGACAGACAGTGGGGGAA
TGATGATCACGTGATATGGGAAAACTTGAAAGTGAAAGATGTAGTGTTTTCATGGAAGACTTGGTCTTGGAAGGTACTGAATGTAGATCTTAATGCATTC
CCTGCTGCATACTACGCCCATCCCGTCGCGGAACAATCATTTGTATTGGGCGGGATCTTCCAGCAATGGAGATTCTTTTGTTTTGGCATTTGA
AA sequence
>Lus10001873 pacid=23181646 polypeptide=Lus10001873 locus=Lus10001873.g ID=Lus10001873.BGIv1.0 annot-version=v1.0
MKSLREDMVIDIFTRLPDDDDDELIMLAIQTNNNDDDDELIMSTIQTNNNDDDELIMSAIQTNNINYFPTINRNLVVPVKSPYSIVGSCNGLLILYMQFN
PTAKFALWNPATNEFGWVPDLDLRSPFSDLITRRFSICESFGFGFDVIATDYKFVKFVSFYDRQWGNDDHVIWENLKVKDVVFSWKTWSWKVLNVDLNAF
PAAYYAHPVAEQSFVLGGIFQQWRFFCFGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10001873 0 1

Lus10001873 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.