Lus10001888 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18593 148 / 8e-47 dual specificity protein phosphatase-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013914 285 / 1e-100 AT4G18593 148 / 1e-46 dual specificity protein phosphatase-related (.1)
Lus10013913 222 / 5e-76 AT4G18593 169 / 6e-55 dual specificity protein phosphatase-related (.1)
Lus10022402 125 / 2e-35 AT4G18593 147 / 2e-43 dual specificity protein phosphatase-related (.1)
Lus10018112 125 / 2e-35 AT4G18593 148 / 5e-44 dual specificity protein phosphatase-related (.1)
Lus10001890 56 / 3e-11 ND 62 / 6e-14
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G056600 162 / 2e-52 AT4G18593 172 / 2e-56 dual specificity protein phosphatase-related (.1)
Potri.006G040300 122 / 2e-34 AT4G18593 148 / 5e-44 dual specificity protein phosphatase-related (.1)
Potri.016G035700 122 / 3e-34 AT4G18593 149 / 3e-44 dual specificity protein phosphatase-related (.1)
PFAM info
Representative CDS sequence
>Lus10001888 pacid=23179015 polypeptide=Lus10001888 locus=Lus10001888.g ID=Lus10001888.BGIv1.0 annot-version=v1.0
ATGGCGATCGAGAACTTGAACTCGGCAGCTGGGACAGAAGAAACTTCGCCTGCAGGCAATGAATGTACTGCACTCCAGACATTCGGACTCGTCTACCGGT
GCAAAAAGTGTCGAAAAATCATTGCATATGATGACAACATAGTCACTCACGAGCGCGGTAAGGGCCCAGAGTCGTTCAAATGGAAGAAGAGAAGACATGA
TCCTGTAGGAACTGCTCCAGCCGAGTGCTCCTCCATCTTTGTTGAGCCCATGGAGTGGATGCAAACAGGTAAAGGCTATGTGGGGAATAAGCTTCAGTGC
GTCGGGTGCAACACGAGGTTGGGTTCGTTCAACTGGGCCGGAATGCAGTGCAACTGCGGTGCTTGGGTTAACCCTGCATTTCAACTTCACAAGAACAGAT
TGGACGAATGTCCCTTATGA
AA sequence
>Lus10001888 pacid=23179015 polypeptide=Lus10001888 locus=Lus10001888.g ID=Lus10001888.BGIv1.0 annot-version=v1.0
MAIENLNSAAGTEETSPAGNECTALQTFGLVYRCKKCRKIIAYDDNIVTHERGKGPESFKWKKRRHDPVGTAPAECSSIFVEPMEWMQTGKGYVGNKLQC
VGCNTRLGSFNWAGMQCNCGAWVNPAFQLHKNRLDECPL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18593 dual specificity protein phosp... Lus10001888 0 1
AT4G38380 MATE efflux family protein (.1... Lus10020203 12.1 0.7791
AT4G00165 Bifunctional inhibitor/lipid-t... Lus10009282 15.7 0.7857
AT4G14660 NRPE7 RNA polymerase Rpb7-like, N-te... Lus10024250 16.4 0.7748
AT5G40410 Tetratricopeptide repeat (TPR)... Lus10005638 16.6 0.6730
AT5G50090 unknown protein Lus10042139 17.9 0.7156
Lus10010925 20.5 0.7303
AT3G07130 ATPAP15, PAP15 purple acid phosphatase 15 (.1... Lus10016665 25.1 0.7498
AT5G67360 ARA12 Subtilase family protein (.1) Lus10029570 27.8 0.7664
AT5G41050 Pollen Ole e 1 allergen and ex... Lus10041541 32.0 0.7312
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10041097 37.2 0.7477

Lus10001888 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.