Lus10001892 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06330 86 / 2e-21 Heavy metal transport/detoxification superfamily protein (.1)
AT3G56891 85 / 4e-21 Heavy metal transport/detoxification superfamily protein (.1)
AT2G18196 80 / 4e-19 Heavy metal transport/detoxification superfamily protein (.1)
AT1G71050 70 / 2e-15 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
AT4G08570 70 / 2e-15 Heavy metal transport/detoxification superfamily protein (.1)
AT4G10465 69 / 5e-15 Heavy metal transport/detoxification superfamily protein (.1)
AT5G27690 70 / 2e-14 Heavy metal transport/detoxification superfamily protein (.1)
AT1G22990 65 / 1e-13 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1)
AT1G29100 62 / 8e-13 Heavy metal transport/detoxification superfamily protein (.1)
AT4G35060 61 / 3e-12 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013911 213 / 3e-71 AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1)
Lus10010147 87 / 1e-21 AT2G18196 165 / 5e-52 Heavy metal transport/detoxification superfamily protein (.1)
Lus10020704 82 / 6e-20 AT1G06330 173 / 3e-56 Heavy metal transport/detoxification superfamily protein (.1)
Lus10033250 82 / 7e-20 AT2G18196 251 / 3e-86 Heavy metal transport/detoxification superfamily protein (.1)
Lus10008284 82 / 1e-19 AT2G18196 246 / 4e-84 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016436 73 / 1e-16 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1)
Lus10019676 73 / 1e-16 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016812 73 / 2e-16 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1)
Lus10022508 73 / 2e-16 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G065600 110 / 3e-31 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1)
Potri.004G056800 99 / 6e-27 AT1G06330 147 / 4e-46 Heavy metal transport/detoxification superfamily protein (.1)
Potri.019G107500 96 / 1e-25 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1)
Potri.019G106500 91 / 1e-23 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1)
Potri.006G024800 89 / 7e-23 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1)
Potri.001G452400 84 / 1e-20 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1)
Potri.011G149500 81 / 2e-19 AT2G18196 257 / 9e-89 Heavy metal transport/detoxification superfamily protein (.1)
Potri.005G079800 77 / 3e-18 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1)
Potri.007G087300 76 / 9e-18 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1)
Potri.005G167000 70 / 1e-15 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Lus10001892 pacid=23179007 polypeptide=Lus10001892 locus=Lus10001892.g ID=Lus10001892.BGIv1.0 annot-version=v1.0
ATGTGCTGCCACGGCTGCGAGCTGAAGATCAAGAAGGCGCTTCGAAGGCTAGACGGAGTTAACGAAATAGACATAGACATGTCAACGCAGAAGGTGACGG
TGATGGGCTACGTTGACCAAGAAACCGTCCTCAAAGCCGTTAGGAAGACCGGGAGAAGAGCCGAGCTGTGGCCGTACGGTTACAACCCTTCAGAGTATAC
GAGGTTCAACCAGCAGAACTACAATTACCTGCAGCAGCCGGCTTATCTCTTGCAAAACCAGCCGCCGCCGCAGCAGCCAGCGCCGTCAGCGCCACCTTAT
GAGGATGTTGTAGATAATGATGATAATCAGTACCACGTCGTTGACTACGATCAACAAGGTCGTGTTGGGTATACGGCTTCTTATGATGATGAGGATAGCT
ACTATAGGGATTATCAACGACGGCCGGTGCTGTACTCGTTCGCCGACCAGCAGCCGGCGGCAGCCATGTTTAGTGACGAGAATCCGCATGCTTGTTCCAT
GATGTGA
AA sequence
>Lus10001892 pacid=23179007 polypeptide=Lus10001892 locus=Lus10001892.g ID=Lus10001892.BGIv1.0 annot-version=v1.0
MCCHGCELKIKKALRRLDGVNEIDIDMSTQKVTVMGYVDQETVLKAVRKTGRRAELWPYGYNPSEYTRFNQQNYNYLQQPAYLLQNQPPPQQPAPSAPPY
EDVVDNDDNQYHVVDYDQQGRVGYTASYDDEDSYYRDYQRRPVLYSFADQQPAAAMFSDENPHACSMM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06330 Heavy metal transport/detoxifi... Lus10001892 0 1
AT1G20180 Protein of unknown function (D... Lus10017348 1.4 0.8445
AT1G47530 MATE efflux family protein (.1... Lus10002366 16.9 0.7562
AT1G50680 AP2_ERF AP2/B3 transcription factor fa... Lus10021848 28.5 0.7499
AT5G36930 Disease resistance protein (TI... Lus10027920 71.2 0.6679
AT1G06870 Plsp2A plastidic type I signal peptid... Lus10011670 99.0 0.6790
Lus10010046 109.4 0.6641
AT5G20630 ATGER3, GLP3A, ... GERMIN-LIKE PROTEIN 3, ARABIDO... Lus10015643 117.2 0.6829
AT1G28380 NSL1 necrotic spotted lesions 1, MA... Lus10021803 142.1 0.6895
AT5G06250 B3 AP2/B3-like transcriptional fa... Lus10004226 146.7 0.6923

Lus10001892 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.