Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18596 147 / 2e-45 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G29140 146 / 4e-45 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 140 / 6e-43 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G08685 108 / 1e-30 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G10130 89 / 1e-22 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 79 / 6e-19 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT2G33790 48 / 6e-07 ATAGP30 arabinogalactan protein 30 (.1) AT3G09925 43 / 2e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G26960 42 / 6e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G05500 41 / 0.0001 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013908 [exp] 321 / 3e-110 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3) Lus10028134 [exp] 116 / 3e-33 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 112 / 1e-31 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 107 / 1e-29 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 106 / 3e-29 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10018131 [exp] 105 / 5e-29 AT1G29140 118 / 5e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 97 / 7e-26 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014332 [exp] 96 / 2e-25 AT5G10130 154 / 2e-48 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041707 [exp] 84 / 9e-21 AT5G10130 150 / 9e-47 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G111300 [exp] 134 / 1e-40 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 127 / 9e-38 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G167900 [exp] 110 / 4e-31 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 108 / 2e-30 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 107 / 3e-30 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 102 / 3e-28 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 62 / 1e-11 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G100600 [exp] 55 / 3e-09 AT5G15780 173 / 1e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 50 / 1e-07 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G326200 [exp] 46 / 2e-06 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10001895 pacid=23179010 polypeptide=Lus10001895 locus=Lus10001895.g ID=Lus10001895.BGIv1.0 annot-version=v1.0 ATGAAGAACTCTCAGACCACCAGCATCATCCTAGCAGCAGCAGCACTCTGCTTCTTGACCCTCCTCGGGTCCGCCAATGGCGATGCCTTTAACGTTGAGG GCAAGGTCTACTGCGACACCTGCCGCACCCAGTTCATCACCCGACTCTCCGATTTCATGAAAGATGCGGTGGTGCGTTTGGAGTGCAAAGACCGGGAGGG AGGATCAGTAACCTTTAGTGAAACGGCCATCACAGACGAGCACGGTGTGTTCCACATCCCAGTGACAGGAGACCACGAGGACGAAATCTGCGAGATCAAC CTGATCAAGTCGCCAAGGCCCGATTGTTCGGAGATCCCGAAGCAAGAACACCCGAACGACGAAACTGCGAGGATCAGCATCACAAAGCACAATGGGATGA CCACAGGGGAGCGTCAGGCGAATCCGATGGGGTTCATGGTGGCCAAGCCTAAGCCAGAGTGCCTTGAGGTGCTTAAGGAACTCGGCATCCCAGCTCAGGG ATTCCCCGCACCATAA
AA sequence Show only first row Show all	>Lus10001895 pacid=23179010 polypeptide=Lus10001895 locus=Lus10001895.g ID=Lus10001895.BGIv1.0 annot-version=v1.0 MKNSQTTSIILAAAALCFLTLLGSANGDAFNVEGKVYCDTCRTQFITRLSDFMKDAVVRLECKDREGGSVTFSETAITDEHGVFHIPVTGDHEDEICEIN LIKSPRPDCSEIPKQEHPNDETARISITKHNGMTTGERQANPMGFMVAKPKPECLEVLKELGIPAQGFPAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29140			Pollen Ole e 1 allergen and ex...		Lus10001895 [exp]	0	1
AT1G65480		FT	FLOWERING LOCUS T, PEBP (phosp...		Lus10013532 [exp]	4.2	0.8981
					Lus10033900 [exp]	7.7	0.8898
					Lus10014195 [exp]	8.2	0.8956
AT1G71530			Protein kinase superfamily pro...		Lus10001470 [exp]	12.8	0.8872
					Lus10042024 [exp]	14.3	0.8854
AT2G36640		ATECP63	embryonic cell protein 63 (.1)		Lus10035586 [exp]	16.6	0.8435
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10009583 [exp]	17.3	0.8753
					Lus10038267 [exp]	18.8	0.8468
AT5G52170	HD	HDG7	homeodomain GLABROUS 7 (.1)		Lus10035095 [exp]	19.3	0.8748
AT4G31920	GARP	ARR10	response regulator 10 (.1)		Lus10025044 [exp]	20.2	0.8749

Compare expression of checked genes

Lus10001895 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.